Recombinant Mouse Srgn protein, His-tagged
Cat.No. : | Srgn-6321M |
Product Overview : | Recombinant Mouse Srgn protein(P13609)(75-152aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 75-152aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 15.3 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | EGPSKDFISNYDDYGSGSGSGSGSGSGSGSGSGSGFLGDMEWEYQPTDESNIVYFNYKPFDRILTEQNQDQPEDDFII |
Gene Name | Srgn serglycin [ Mus musculus ] |
Official Symbol | Srgn |
Synonyms | SRGN; serglycin; gp600; proteoglycan, secretory granule; proteoglycan 1, secretory granule; mastocytoma proteoglycan core protein; secretory granule proteoglycan core protein; Prg; Sgc; Prg1; |
Gene ID | 19073 |
mRNA Refseq | NM_011157 |
Protein Refseq | NP_035287 |
◆ Recombinant Proteins | ||
SRGN-2952H | Recombinant Human SRGN, GST-tagged | +Inquiry |
SRGN-15982M | Recombinant Mouse SRGN Protein | +Inquiry |
SRGN-5741R | Recombinant Rat SRGN Protein | +Inquiry |
SRGN-31397TH | Recombinant Human SRGN | +Inquiry |
SRGN-8716M | Recombinant Mouse SRGN Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SRGN-1119HCL | Recombinant Human SRGN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Srgn Products
Required fields are marked with *
My Review for All Srgn Products
Required fields are marked with *