Recombinant Mouse Srgn protein, His-tagged
| Cat.No. : | Srgn-6321M |
| Product Overview : | Recombinant Mouse Srgn protein(P13609)(75-152aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 75-152aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 15.3 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | EGPSKDFISNYDDYGSGSGSGSGSGSGSGSGSGSGFLGDMEWEYQPTDESNIVYFNYKPFDRILTEQNQDQPEDDFII |
| Gene Name | Srgn serglycin [ Mus musculus ] |
| Official Symbol | Srgn |
| Synonyms | SRGN; serglycin; gp600; proteoglycan, secretory granule; proteoglycan 1, secretory granule; mastocytoma proteoglycan core protein; secretory granule proteoglycan core protein; Prg; Sgc; Prg1; |
| Gene ID | 19073 |
| mRNA Refseq | NM_011157 |
| Protein Refseq | NP_035287 |
| ◆ Recombinant Proteins | ||
| SRGN-31397TH | Recombinant Human SRGN | +Inquiry |
| SRGN-31460TH | Recombinant Human SRGN | +Inquiry |
| Srgn-2104R | Recombinant Rat Srgn Protein, His&GST-tagged | +Inquiry |
| SRGN-513H | Recombinant Human SRGN, His tagged | +Inquiry |
| SRGN-5400R | Recombinant Rat SRGN Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SRGN-1119HCL | Recombinant Human SRGN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Srgn Products
Required fields are marked with *
My Review for All Srgn Products
Required fields are marked with *



