Recombinant Human SRGN

Cat.No. : SRGN-31460TH
Product Overview : Recombinant fragment of Human SRGN with N terminal proprietary tag; Predicted MW 32.89kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 66 amino acids
Description : This gene encodes a protein best known as a hematopoietic cell granule proteoglycan. Proteoglycans stored in the secretory granules of many hematopoietic cells also contain a protease-resistant peptide core, which may be important for neutralizing hydrolytic enzymes. This encoded protein was found to be associated with the macromolecular complex of granzymes and perforin, which may serve as a mediator of granule-mediated apoptosis. Two transcript variants, only one of them protein-coding, have been found for this gene.
Molecular Weight : 32.890kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : PTRRARYQWVRCNPDSNSANCLEEKGPMFELLPGESNKIPRLRTDLFPKTRIQDLNRIFPLSEDYS
Sequence Similarities : Belongs to the serglycin family.
Gene Name SRGN serglycin [ Homo sapiens ]
Official Symbol SRGN
Synonyms SRGN; serglycin; PRG, PRG1, proteoglycan 1, secretory granule; PPG; serglycin proteoglycan;
Gene ID 5552
mRNA Refseq NM_002727
Protein Refseq NP_002718
MIM 177040
Uniprot ID P10124
Chromosome Location 10q22.1
Pathway Hemostasis, organism-specific biosystem; Platelet activation, signaling and aggregation, organism-specific biosystem; Platelet degranulation, organism-specific biosystem; Response to elevated platelet cytosolic Ca2+, organism-specific biosystem;
Function collagen binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SRGN Products

Required fields are marked with *

My Review for All SRGN Products

Required fields are marked with *

0
cart-icon