Recombinant Mouse Stc1 protein, His-GST-tagged

Cat.No. : Stc1-20M
Product Overview : Recombinant Mouse Stc1(Ser28~Ala247) fused with His-GST tag at N-terminal was expressed in E. coli.
Availability November 08, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : GST&His
Protein Length : Ser28-Ala247
Form : PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
Molecular Mass : Predicted Molecular Mass: 54.7 kDa
Accurate Molecular Mass: 55 kDa as determined by SDS-PAGE reducing conditions.
AA Sequence : SPRKSRVAAQNSAEVVRCLNSALQVGCGAFACLENSTCDTDGMYDICKSFLYSAAKFDTQGKAFVKESLKCIANGITSKVFLAIRRCSTFQEMIAEVQEDCYSKLNVCSIAKRNPEAITEVIQLPNHFSNRYYNRLVRSLLECDEDTVSTIRDSLMEKIGPNMASLFHILQTDHCAQTHPRADFNRRRTNEPQKLKVLLRNLRGEGDSPSHIKRTSQESA
Endotoxin : <1.0EU per 1µg (determined by the LAL method)
Purity : > 97%
Applications : SDS-PAGE; WB; ELISA; IP; CoIP; Purification; Amine Reactive Labeling.
Stability : The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37 centigrade for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.
Storage : Avoid repeated freeze/thaw cycles. Store at 2-8 centigrade for one month. Aliquot and store at -80 centigrade for 12 months.
Concentration : 200ug/mL
Reconstitution : Reconstitute in 10mM PBS (pH7.4) to a concentration of 0.1-1.0 mg/mL. Do not vortex.
Publications :
Stanniocalcin 1 is a phagocytosis checkpoint driving tumor immune resistance (2021)
Gene Name Stc1 stanniocalcin 1 [ Mus musculus ]
Official Symbol Stc1
Synonyms STC1; stanniocalcin 1; stanniocalcin-1; STC-1; Stc;
Gene ID 20855
mRNA Refseq NM_009285
Protein Refseq NP_033311
UniProt ID O55183

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Stc1 Products

Required fields are marked with *

My Review for All Stc1 Products

Required fields are marked with *

0
cart-icon
0
compare icon