Recombinant Mouse Stim1 protein

• Cat.No.: Stim1-5127M
• Product Overview: Recombinant Mouse Stim1 protein(P70302)(23-213 aa) was expressed in Yeast.

Specification

• Species: Mouse
• Source: Yeast
• Tag: Non
• Protein Length: 23-213 aa
• Form: Tris/PBS-based buffer, 6% Trehalose.
• AASequence: LSHSHSEKNTGASSGATSEESTEAEFCRIDKPLCHSEDEKLSFEAVRNIHKLMDDDANGD VDVEESDEFLREDLNYHDPTVKHSTFHGEDKLISVEDLWKAWKSSEVYNWTVDEVIQWLI TYVELPQYEETFRKLQLTGHAMPRLAVTNTTMTGTVLKMTDRSHRQKLQLKALDTVLFGP PLLTRHNHLKD
• Purity: >85% (SDS-PAGE)
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: Stim1 stromal interaction molecule 1 [ Mus musculus ]
• Official Symbol: Stim1
• Synonyms: STIM1; stromal interaction molecule 1; SIM
• Gene ID: 20866
• mRNA Refseq: NM_009287
• Protein Refseq: NP_033313