Recombinant Mouse Stim1 protein
Cat.No. : | Stim1-5127M |
Product Overview : | Recombinant Mouse Stim1 protein(P70302)(23-213 aa) was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Tag : | Non |
Protein Length : | 23-213 aa |
Form : | Tris/PBS-based buffer, 6% Trehalose. |
AASequence : | LSHSHSEKNTGASSGATSEESTEAEFCRIDKPLCHSEDEKLSFEAVRNIHKLMDDDANGD VDVEESDEFLREDLNYHDPTVKHSTFHGEDKLISVEDLWKAWKSSEVYNWTVDEVIQWLI TYVELPQYEETFRKLQLTGHAMPRLAVTNTTMTGTVLKMTDRSHRQKLQLKALDTVLFGP PLLTRHNHLKD |
Purity : | >85% (SDS-PAGE) |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | Stim1 stromal interaction molecule 1 [ Mus musculus ] |
Official Symbol | Stim1 |
Synonyms | STIM1; stromal interaction molecule 1; SIM; |
Gene ID | 20866 |
mRNA Refseq | NM_009287 |
Protein Refseq | NP_033313 |
◆ Recombinant Proteins | ||
STIM1-5447R | Recombinant Rat STIM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Stim1-5129M | Recombinant Mouse Stim1 protein, Avi-tagged, Biotinylated | +Inquiry |
RFL23771RF | Recombinant Full Length Rat Stromal Interaction Molecule 1(Stim1) Protein, His-Tagged | +Inquiry |
Stim1-5130M | Recombinant Mouse Stim1 protein | +Inquiry |
STIM1-2858H | Recombinant Human STIM1 protein(31-210 aa), C-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
STIM1-2277HCL | Recombinant Human STIM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Stim1 Products
Required fields are marked with *
My Review for All Stim1 Products
Required fields are marked with *