Recombinant Mouse Stim1 protein

Cat.No. : Stim1-5128M
Product Overview : Recombinant Mouse Stim1 protein(P70302)(23-213 aa) was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : Non
Protein Length : 23-213 aa
Form : Tris/PBS-based buffer, 6% Trehalose.
AASequence : LSHSHSEKNTGASSGATSEESTEAEFCRIDKPLCHSEDEKLSFEAVRNIHKLMDDDANGD VDVEESDEFLREDLNYHDPTVKHSTFHGEDKLISVEDLWKAWKSSEVYNWTVDEVIQWLI TYVELPQYEETFRKLQLTGHAMPRLAVTNTTMTGTVLKMTDRSHRQKLQLKALDTVLFGP PLLTRHNHLKD
Purity : >85% (SDS-PAGE)
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. 
Gene Name Stim1 stromal interaction molecule 1 [ Mus musculus ]
Official Symbol Stim1
Synonyms STIM1; stromal interaction molecule 1; SIM;
Gene ID 20866
mRNA Refseq NM_009287
Protein Refseq NP_033313

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Stim1 Products

Required fields are marked with *

My Review for All Stim1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon