Recombinant Mouse Tdo2 protein, His-tagged
| Cat.No. : | Tdo2-3559M |
| Product Overview : | Recombinant Mouse Tdo2 protein(P48776)(1-406aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-406aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 53.3 kDa |
| AA Sequence : | MSGCPFAGNSVGYTLKNVSMEDNEEDRAQTGVNRASKGGLIYGNYLQLEKILNAQELQSEVKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVIARMHRVVVIFKLLVQQFSVLETMTALDFNDFREYLSPASGFQSLQFRLLENKIGVLQSLRVPYNRKHYRDNFGGDYNELLLKSEQEQTLLQLVEAWLERTPGLEPNGFNFWGKFEKNILKGLEEEFLRIQAKTDSEEKEEQMAEFRKQKEVLLCLFDEKRHDYLLSKGERRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDIDTLMTKWRYNHVCMVHRMLGTKAGTGGSSGYHYLRSTVSDRYKVFVDLFNLSTYLVPRHWVPKMNPIIHKFLYTAEYSDSSYFSSDESD |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Tdo2 tryptophan 2,3-dioxygenase [ Mus musculus ] |
| Official Symbol | Tdo2 |
| Synonyms | TDO2; tryptophan 2,3-dioxygenase; TRPO; tdo variant1; tdo variant2; tryptophanase; tryptophan oxygenase; tryptophan pyrrolase; tryptamin 2,3-dioxygenase; tryptophan-2,3-dioxygenase; TO; TDO; chky; AA407491; |
| Gene ID | 56720 |
| mRNA Refseq | NM_019911 |
| Protein Refseq | NP_064295 |
| ◆ Recombinant Proteins | ||
| TDO2-5997R | Recombinant Rat TDO2 Protein | +Inquiry |
| TDO2-3408H | Recombinant Human TDO2 protein, His-tagged | +Inquiry |
| TDO2-4170H | Recombinant Human TDO2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Tdo2-3559M | Recombinant Mouse Tdo2 protein, His-tagged | +Inquiry |
| TDO2-3558H | Recombinant Human TDO2 protein, His-SUMO-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TDO2-1156HCL | Recombinant Human TDO2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tdo2 Products
Required fields are marked with *
My Review for All Tdo2 Products
Required fields are marked with *
