Recombinant Mouse Tead3 protein, Avi-tagged, Biotinylated
Cat.No. : | Tead3-4841M |
Product Overview : | Biotinylated Recombinant Mouse Tead3 protein(P70210)(2-439 aa), fused with Avi tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | Avi |
Protein Length : | 2-439 aa |
Conjugation/Label : | Biotin |
Form : | Tris/PBS-based buffer, 6% Trehalose. |
AASequence : | ASNSWTANSSPGEAREDGSEGLDKGLDNDAEGVWSPDIEQSFQEALAIYPPCGRRKIILS DEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARKKVREYQVGIKAMNLDQVSKDK ALQSMASMSSAQIVSASVLQNKFSPPSPLPQAVFSSSSRFWSSPPLLGQQPGPSQDIKPF AQPAYPIQPPLPPALNSYESLAPLPPAAASATASAPAWQDRTIASSRLRLLEYSAFMEVQ RDPDTYSKHLFVHIGQTNPAFSDPPLEAVDVRQIYDKFPEKKGGLKELYEKGPPNAFFLV KFWADLNSTIQEGPGAFYGVSSQYSSADSMTISVSTKVCSFGKQVVEKVETEYARLENGR FVYRIHRSPMCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTSRDSQETLLVIAFVFE VSTSEHGAQHHVYKLVKD |
Purity : | >85% (SDS-PAGE) |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
Gene Name | Tead3 TEA domain family member 3 [ Mus musculus ] |
Official Symbol | Tead3 |
Synonyms | TEAD3; TEA domain family member 3; transcriptional enhancer factor TEF-5; ETF-related factor 1; TEF-5; DTEF-1; ETFR-1; TEAD-3; Tcf13r2; |
Gene ID | 21678 |
mRNA Refseq | NM_001098226 |
Protein Refseq | NP_001091696 |
◆ Recombinant Proteins | ||
Tead3-4839M | Recombinant Mouse Tead3 protein | +Inquiry |
Tead3-4842M | Recombinant Mouse Tead3 protein | +Inquiry |
Tead3-4841M | Recombinant Mouse Tead3 protein, Avi-tagged, Biotinylated | +Inquiry |
TEAD3-1382H | Recombinant Human TEAD3 Protein, His-SUMO-tagged | +Inquiry |
Tead3-4840M | Recombinant Mouse Tead3 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TEAD3-1154HCL | Recombinant Human TEAD3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tead3 Products
Required fields are marked with *
My Review for All Tead3 Products
Required fields are marked with *