Recombinant Human TEAD3 protein, GST-tagged
Cat.No. : | TEAD3-27H |
Product Overview : | Recombinant Human TEAD3(1 a.a. - 324 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1 a.a. - 324 a.a. |
Description : | This gene product is a member of the transcriptional enhancer factor (TEF) family of transcription factors, which contain the TEA/ATTS DNA-binding domain. It is predominantly expressed in the placenta and is involved in the transactivation of the chorionic somatomammotropin-B gene enhancer. Translation of this protein is initiated at a non-AUG (AUA) start codon. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 62.7 kDa |
AA Sequence : | MNLDQVSKDKALQSMASMSSAQIVSASVLQNKFSPPSPLPQAVFSTSSRFWSSPPLLGQQPGPSQDIKPFAQPAYPIQPPLPPTLSSYEPLAPLPSAAASVPVWQDRTIASSRLRLLEYSAFMEVQRDPDTYSKHLFVHIGQTNPAFSDPPLEAVDVRQIYDKFPEKKGGLKELYEKGPPNAFFLVKFWADLNSTIQEGPGAFYGVSSQYSSADSMTISVSTKVCSFGKQVVEKVETEYARLENGRFVYRIHRSPMCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTSRDSQETLLVIAFVFEVSTSEHGAQHHVYKLVKD |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | TEAD3 TEA domain family member 3 [ Homo sapiens ] |
Official Symbol | TEAD3 |
Synonyms | TEAD3; TEA domain family member 3; TEAD5; transcriptional enhancer factor TEF-5; ETFR 1; TEF 5; TEA domain family member 5; transcriptional enhancer factor 5; transcriptional enhancer factor TEF-5 (DTEF-1); TEF5; TEF-5; DTEF-1; ETFR-1; TEAD-3; |
Gene ID | 7005 |
mRNA Refseq | NM_003214 |
Protein Refseq | NP_003205 |
MIM | 603170 |
UniProt ID | Q99594 |
Chromosome Location | 6p21.2 |
Pathway | Fatty acid, triacylglycerol, and ketone body metabolism, organism-specific biosystem; Gene Expression, organism-specific biosystem; Generic Transcription Pathway, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; PPARA Activates Gene Expression, organism-specific biosystem; Regulation of Lipid Metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha), organism-specific biosystem; |
Function | DNA binding; protein binding; sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
TEAD3-1382H | Recombinant Human TEAD3 Protein, His-SUMO-tagged | +Inquiry |
Tead3-4843M | Recombinant Mouse Tead3 protein | +Inquiry |
TEAD3-27H | Recombinant Human TEAD3 protein, GST-tagged | +Inquiry |
Tead3-4842M | Recombinant Mouse Tead3 protein | +Inquiry |
TEAD3-28H | Recombinant Human TEAD3 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TEAD3-1154HCL | Recombinant Human TEAD3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TEAD3 Products
Required fields are marked with *
My Review for All TEAD3 Products
Required fields are marked with *