Recombinant Mouse Tead4 protein

• Cat.No.: Tead4-4587M
• Product Overview: Recombinant Mouse Tead4 protein(Q62296)(210-427aa) was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: Non
• Protein Length: 210-427aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 25.7 kDa
• AA Sequence: RSIASSKLWMLEFSAFLERQQDPDTYNKHLFVHISQSSPSYSDPYLETVDIRQIYDKFPEKKGGLKELFERGPSNAFFLVKFWADLNTNIDDEGSAFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYLYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: Tead4 TEA domain family member 4 [ Mus musculus ]
• Official Symbol: Tead4
• Synonyms: TEAD4; TEA domain family member 4; transcriptional enhancer factor TEF-3; RTEF-1; FGF-regulated 19; ETF-related factor 2; ETF-related factor-2; TEF-1-related factor 1; TEF-1-related factor FR-19; Tef3; Tefr; Etfr2; FR-19; TEF-3; Tefr1; ETFR-2; TEAD-4; Tefr1a; Tcf13r1
• Gene ID: 21679
• mRNA Refseq: NM_001080979
• Protein Refseq: NP_001074448