Recombinant Human TEAD4 protein, His&His-tagged
Cat.No. : | TEAD4-4597H |
Product Overview : | Recombinant Human TEAD4 protein(Q15561)(217-434 aa), fused with N-terminal His tag and C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 217-434 aa |
Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
Molecular Mass : | 35.5 kDa |
AASequence : | RSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
Gene Name | TEAD4 TEA domain family member 4 [ Homo sapiens ] |
Official Symbol | TEAD4 |
Synonyms | TEAD4; TEA domain family member 4; TCF13L1; transcriptional enhancer factor TEF-3; EFTR 2; RTEF 1; TEF 3; TEFR 1; transcription factor RTEF-1; transcription factor 13-like 1; transcriptional enhancer factor 3; related transcription enhancer factor 1B; transcriptional enhancer factor 1-related; TEF3; RTEF1; TEF-3; EFTR-2; TEFR-1; hRTEF-1B; MGC9014; |
Gene ID | 7004 |
mRNA Refseq | NM_003213 |
Protein Refseq | NP_003204 |
MIM | 601714 |
UniProt ID | Q15561 |
◆ Recombinant Proteins | ||
TEAD4-1099C | Recombinant Chicken TEAD4 | +Inquiry |
TEAD4-3175H | Recombinant Human TEAD4 protein, GST-tagged | +Inquiry |
TEAD4-4397H | Recombinant Human TEAD4 protein, GST-tagged | +Inquiry |
TEAD4-9116M | Recombinant Mouse TEAD4 Protein, His (Fc)-Avi-tagged | +Inquiry |
TEAD4-6335C | Recombinant Chicken TEAD4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
TEAD4-1758HCL | Recombinant Human TEAD4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TEAD4 Products
Required fields are marked with *
My Review for All TEAD4 Products
Required fields are marked with *