Recombinant Mouse Tead4 protein, His&Myc-tagged
| Cat.No. : | Tead4-4586M |
| Product Overview : | Recombinant Mouse Tead4 protein(Q62296)(210-427aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 210-427aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 33.0 kDa |
| AA Sequence : | RSIASSKLWMLEFSAFLERQQDPDTYNKHLFVHISQSSPSYSDPYLETVDIRQIYDKFPEKKGGLKELFERGPSNAFFLVKFWADLNTNIDDEGSAFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYLYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Gene Name | Tead4 TEA domain family member 4 [ Mus musculus ] |
| Official Symbol | Tead4 |
| Synonyms | TEAD4; TEA domain family member 4; transcriptional enhancer factor TEF-3; RTEF-1; FGF-regulated 19; ETF-related factor 2; ETF-related factor-2; TEF-1-related factor 1; TEF-1-related factor FR-19; Tef3; Tefr; Etfr2; FR-19; TEF-3; Tefr1; ETFR-2; TEAD-4; Tefr1a; Tcf13r1; |
| Gene ID | 21679 |
| mRNA Refseq | NM_001080979 |
| Protein Refseq | NP_001074448 |
| ◆ Recombinant Proteins | ||
| TEAD4-9116M | Recombinant Mouse TEAD4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TEAD4-16620M | Recombinant Mouse TEAD4 Protein | +Inquiry |
| TEAD4-3175H | Recombinant Human TEAD4 protein, GST-tagged | +Inquiry |
| TEAD4-4397H | Recombinant Human TEAD4 protein, GST-tagged | +Inquiry |
| TEAD4-1099C | Recombinant Chicken TEAD4 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TEAD4-1758HCL | Recombinant Human TEAD4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tead4 Products
Required fields are marked with *
My Review for All Tead4 Products
Required fields are marked with *



