Recombinant Mouse Tead4 protein, His&Myc-tagged

Cat.No. : Tead4-4586M
Product Overview : Recombinant Mouse Tead4 protein(Q62296)(210-427aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His&Myc
Protein Length : 210-427aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 33.0 kDa
AA Sequence : RSIASSKLWMLEFSAFLERQQDPDTYNKHLFVHISQSSPSYSDPYLETVDIRQIYDKFPEKKGGLKELFERGPSNAFFLVKFWADLNTNIDDEGSAFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYLYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name Tead4 TEA domain family member 4 [ Mus musculus ]
Official Symbol Tead4
Synonyms TEAD4; TEA domain family member 4; transcriptional enhancer factor TEF-3; RTEF-1; FGF-regulated 19; ETF-related factor 2; ETF-related factor-2; TEF-1-related factor 1; TEF-1-related factor FR-19; Tef3; Tefr; Etfr2; FR-19; TEF-3; Tefr1; ETFR-2; TEAD-4; Tefr1a; Tcf13r1;
Gene ID 21679
mRNA Refseq NM_001080979
Protein Refseq NP_001074448

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Tead4 Products

Required fields are marked with *

My Review for All Tead4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon