Recombinant Human TEAD4 protein, GST-tagged
| Cat.No. : | TEAD4-3175H |
| Product Overview : | Recombinant Human TEAD4 protein(135-434 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | November 02, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 135-434 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | SAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | TEAD4 TEA domain family member 4 [ Homo sapiens ] |
| Official Symbol | TEAD4 |
| Synonyms | TEAD4; TEA domain family member 4; TCF13L1; transcriptional enhancer factor TEF-3; EFTR 2; RTEF 1; TEF 3; TEFR 1; transcription factor RTEF-1; transcription factor 13-like 1; transcriptional enhancer factor 3; related transcription enhancer factor 1B; transcriptional enhancer factor 1-related; TEF3; RTEF1; TEF-3; EFTR-2; TEFR-1; hRTEF-1B; MGC9014; |
| Gene ID | 7004 |
| mRNA Refseq | NM_003213 |
| Protein Refseq | NP_003204 |
| MIM | 601714 |
| UniProt ID | Q15561 |
| ◆ Recombinant Proteins | ||
| TEAD4-9116M | Recombinant Mouse TEAD4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TEAD4-1099C | Recombinant Chicken TEAD4 | +Inquiry |
| TEAD4-3175H | Recombinant Human TEAD4 protein, GST-tagged | +Inquiry |
| TEAD4-1101C | Recombinant Chicken TEAD4 | +Inquiry |
| TEAD4-4396H | Recombinant Human TEAD4 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TEAD4-1758HCL | Recombinant Human TEAD4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TEAD4 Products
Required fields are marked with *
My Review for All TEAD4 Products
Required fields are marked with *
