Recombinant Human TEAD4 protein, GST-tagged
Cat.No. : | TEAD4-3175H |
Product Overview : | Recombinant Human TEAD4 protein(135-434 aa), fused with GST tag, was expressed in E.coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 135-434 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | SAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | TEAD4 TEA domain family member 4 [ Homo sapiens ] |
Official Symbol | TEAD4 |
Synonyms | TEAD4; TEA domain family member 4; TCF13L1; transcriptional enhancer factor TEF-3; EFTR 2; RTEF 1; TEF 3; TEFR 1; transcription factor RTEF-1; transcription factor 13-like 1; transcriptional enhancer factor 3; related transcription enhancer factor 1B; transcriptional enhancer factor 1-related; TEF3; RTEF1; TEF-3; EFTR-2; TEFR-1; hRTEF-1B; MGC9014; |
Gene ID | 7004 |
mRNA Refseq | NM_003213 |
Protein Refseq | NP_003204 |
MIM | 601714 |
UniProt ID | Q15561 |
◆ Recombinant Proteins | ||
TEAD4-1098C | Recombinant Chicken TEAD4 | +Inquiry |
TEAD4-4397H | Recombinant Human TEAD4 protein, GST-tagged | +Inquiry |
TEAD4-1005H | Recombinant Human TEAD4 Protein (74-434 aa), His-SUMO-tagged | +Inquiry |
TEAD4-6335C | Recombinant Chicken TEAD4 | +Inquiry |
TEAD4-1102C | Recombinant Chicken TEAD4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
TEAD4-1758HCL | Recombinant Human TEAD4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TEAD4 Products
Required fields are marked with *
My Review for All TEAD4 Products
Required fields are marked with *
0
Inquiry Basket