Recombinant Human TEAD4 protein, GST-tagged

• Cat.No.: TEAD4-3175H
• Product Overview: Recombinant Human TEAD4 protein(135-434 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 135-434 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
• AASequence: SAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: TEAD4 TEA domain family member 4 [ Homo sapiens ]
• Official Symbol: TEAD4
• Synonyms: TEAD4; TEA domain family member 4; TCF13L1; transcriptional enhancer factor TEF-3; EFTR 2; RTEF 1; TEF 3; TEFR 1; transcription factor RTEF-1; transcription factor 13-like 1; transcriptional enhancer factor 3; related transcription enhancer factor 1B; transcriptional enhancer factor 1-related; TEF3; RTEF1; TEF-3; EFTR-2; TEFR-1; hRTEF-1B; MGC9014
• Gene ID: 7004
• mRNA Refseq: NM_003213
• Protein Refseq: NP_003204
• MIM: 601714
• UniProt ID: Q15561