Recombinant Mouse Tectb protein, His-B2M-JD & Myc-tagged
Cat.No. : | Tectb-3560M |
Product Overview : | Recombinant Mouse Tectb protein(O08524)(18-305aa), fused to N-terminal His-B2M-JD tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | B2M&His&Myc |
Protein Length : | 18-305aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 39.4 kDa |
AA Sequence : | KSCTPNKADVILVFCYPKTIITKIPECPYGWEVHQLALGGLCYNGVHEGGYYQFVIPDLSPKNKSYCGTQSEYKPPIYHFYSHIVSNDSTVIVKNQPVNYSFSCTYHSTYLVNQAAFDQRVATVHVKNGSMGTFESQLSLNFYTNAKFSTKKEAPFVLETSEIGSDLFAGVEAKGLSVRFKVVLNSCWATPSADFMYPLQWQLINKGCPTDETVLVHENGKDHRATFQFNAFRFQNIPKLSKVWLHCETFICDSEKLSCPVNCDKRKRMLRDQTGGVLVVELSLRSRA |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Tectb tectorin beta [ Mus musculus ] |
Official Symbol | Tectb |
Synonyms | TECTB; tectorin beta; beta-tectorin; [b]-tectorin; Tctnb; |
Gene ID | 21684 |
mRNA Refseq | NM_009348 |
Protein Refseq | NP_033374 |
◆ Recombinant Proteins | ||
Tectb-3560M | Recombinant Mouse Tectb protein, His-B2M-JD & Myc-tagged | +Inquiry |
TECTB-9121M | Recombinant Mouse TECTB Protein, His (Fc)-Avi-tagged | +Inquiry |
TECTB-661H | Recombinant Human TECTB Protein, His-tagged | +Inquiry |
TECTB-662H | Recombinant Human TECTB Protein, His-tagged | +Inquiry |
TECTB-1891Z | Recombinant Zebrafish TECTB | +Inquiry |
◆ Cell & Tissue Lysates | ||
TECTB-661HCL | Recombinant Human TECTB lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tectb Products
Required fields are marked with *
My Review for All Tectb Products
Required fields are marked with *