Recombinant Mouse Tert Protein, His-SUMO-tagged
| Cat.No. : | Tnni3-1388M |
| Product Overview : | Recombinant Mouse Tnni3 Protein (2-211aa) was expressed in E. coli with N-terminal His-SUMO tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 2-211 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 40.1 kDa |
| AA Sequence : | ADESSDAAGEPQPAPAPVRRRSSANYRAYATEPHAKKKSKISASRKLQLKTLMLQIAKQEMEREAEERRG EKGRVLRTRCQPLELDGLGFEELQDLCRQLHARVDKVDEERYDVEAKVTKNITEIADLTQKIYDLRGKFK RPTLRRVRISADAMMQALLGTRAKESLDLRAHLKQVKKEDIEKENREVGDWRKNIDALSGMEGRKKKFEG |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | Tnni3 troponin I, cardiac 3 [ Mus musculus (house mouse) ] |
| Official Symbol | Tnni3 |
| Synonyms | Tn1; cTnI |
| Gene ID | 21954 |
| mRNA Refseq | NM_009406.4 |
| Protein Refseq | NP_033432.1 |
| UniProt ID | P48787 |
| ◆ Recombinant Proteins | ||
| TNNI3-7123C | Recombinant Chicken TNNI3 | +Inquiry |
| TNNI3-1721D | Recombinant Dog TNNI3 protein, His&Myc-tagged | +Inquiry |
| TNNI3-008H | Recombinant Human TNNI3 Protein | +Inquiry |
| Tnni3-6569M | Recombinant Mouse Tnni3 Protein, Myc/DDK-tagged | +Inquiry |
| TNNI3-79H | Recombinant Human TNNI3 | +Inquiry |
| ◆ Native Proteins | ||
| TNNI3-221H | Native Human TNNI3 | +Inquiry |
| TNNI3-01H | Native Human TNNI3 Protein | +Inquiry |
| Tnni3-7423M | Native Mouse Tnni3 Protein | +Inquiry |
| TNNI3-223H | Native Human Troponin I Type 3 (Cardiac) | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TNNI3-1803HCL | Recombinant Human TNNI3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tnni3 Products
Required fields are marked with *
My Review for All Tnni3 Products
Required fields are marked with *
