"Tnni3" Related Products

Expand
Expand

Recombinant Mouse Tert Protein, His-SUMO-tagged

Cat.No.: Tnni3-1388M
Product Overview: Recombinant Mouse Tnni3 Protein (2-211aa) was expressed in E. coli with N-terminal His-SUMO tag.
Source: E. coli
Species: Mouse
Tag : His-SUMO
Form: Tris-based buffer, 50% glycerol.
Molecular Mass: 40.1 kDa
AA Sequence: ADESSDAAGEPQPAPAPVRRRSSANYRAYATEPHAKKKSKISASRKLQLKTLMLQIAKQEMEREAEERRG
EKGRVLRTRCQPLELDGLGFEELQDLCRQLHARVDKVDEERYDVEAKVTKNITEIADLTQKIYDLRGKFK
RPTLRRVRISADAMMQALLGTRAKESLDLRAHLKQVKKEDIEKENREVGDWRKNIDALSGMEGRKKKFEG
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name: Tnni3 troponin I, cardiac 3 [ Mus musculus (house mouse) ]
Official Symbol: Tnni3
Synonyms: Tn1; cTnI
Gene ID: 21954
mRNA Refseq: NM_009406.4
Protein Refseq: NP_033432.1
UniProt ID: P48787

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.