Expand
| Cat.No.: | Tnni3-1388M |
| Product Overview: | Recombinant Mouse Tnni3 Protein (2-211aa) was expressed in E. coli with N-terminal His-SUMO tag. |
| Source: | E. coli |
| Species: | Mouse |
| Tag : | His-SUMO |
| Form: | Tris-based buffer, 50% glycerol. |
| Molecular Mass: | 40.1 kDa |
| AA Sequence: | ADESSDAAGEPQPAPAPVRRRSSANYRAYATEPHAKKKSKISASRKLQLKTLMLQIAKQEMEREAEERRG EKGRVLRTRCQPLELDGLGFEELQDLCRQLHARVDKVDEERYDVEAKVTKNITEIADLTQKIYDLRGKFK RPTLRRVRISADAMMQALLGTRAKESLDLRAHLKQVKKEDIEKENREVGDWRKNIDALSGMEGRKKKFEG |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Storage: | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name: | Tnni3 troponin I, cardiac 3 [ Mus musculus (house mouse) ] |
| Official Symbol: | Tnni3 |
| Synonyms: | Tn1; cTnI |
| Gene ID: | 21954 |
| mRNA Refseq: | NM_009406.4 |
| Protein Refseq: | NP_033432.1 |
| UniProt ID: | P48787 |
Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.
Download Datasheet
See All Tnni3 Products
Download Datasheet