Recombinant Mouse TET2 Protein (1810-1912 aa), His-KSI-tagged

Cat.No. : TET2-2683M
Product Overview : Recombinant Mouse TET2 Protein (1810-1912 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-KSI tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His&KSI
Protein Length : 1810-1912 aa
Form : Tris-based buffer,50% glycerol
Molecular Mass : 27.0 kDa
AA Sequence : RISLVLYRHKNLFLPKHCLALWEAKMAEKARKEEECGKNGSDHVSQKNHGKQEKREPTGPQEPSYLRFIQSLAENTGSVTTDSTVTTSPYAFTQVTGPYNTFV
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name Tet2 tet methylcytosine dioxygenase 2 [ Mus musculus ]
Official Symbol TET2
Synonyms TET2; tet methylcytosine dioxygenase 2; tet oncogene 2; Ayu17-449; mKIAA1546; E130014J05Rik; MGC37385;
Gene ID 214133
mRNA Refseq NM_001040400
Protein Refseq NP_001035490
UniProt ID Q4JK59

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TET2 Products

Required fields are marked with *

My Review for All TET2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon