Recombinant Mouse TET2 Protein (1810-1912 aa), His-KSI-tagged
Cat.No. : | TET2-2683M |
Product Overview : | Recombinant Mouse TET2 Protein (1810-1912 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-KSI tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&KSI |
Protein Length : | 1810-1912 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 27.0 kDa |
AA Sequence : | RISLVLYRHKNLFLPKHCLALWEAKMAEKARKEEECGKNGSDHVSQKNHGKQEKREPTGPQEPSYLRFIQSLAENTGSVTTDSTVTTSPYAFTQVTGPYNTFV |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | Tet2 tet methylcytosine dioxygenase 2 [ Mus musculus ] |
Official Symbol | TET2 |
Synonyms | TET2; tet methylcytosine dioxygenase 2; tet oncogene 2; Ayu17-449; mKIAA1546; E130014J05Rik; MGC37385; |
Gene ID | 214133 |
mRNA Refseq | NM_001040400 |
Protein Refseq | NP_001035490 |
UniProt ID | Q4JK59 |
◆ Recombinant Proteins | ||
TET2-2683M | Recombinant Mouse TET2 Protein (1810-1912 aa), His-KSI-tagged | +Inquiry |
TET2-5947H | Recombinant Human TET2 Protein (Gln1138-Lys1462), N-His tagged | +Inquiry |
TET2-5153C | Recombinant Chicken TET2 | +Inquiry |
TET2-311H | Recombinant Human TET2 protein, His-tagged | +Inquiry |
TET2-9135M | Recombinant Mouse TET2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TET2 Products
Required fields are marked with *
My Review for All TET2 Products
Required fields are marked with *
0
Inquiry Basket