Recombinant Mouse TET2 Protein (1810-1912 aa), His-KSI-tagged
| Cat.No. : | TET2-2683M |
| Product Overview : | Recombinant Mouse TET2 Protein (1810-1912 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-KSI tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&KSI |
| Protein Length : | 1810-1912 aa |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 27.0 kDa |
| AA Sequence : | RISLVLYRHKNLFLPKHCLALWEAKMAEKARKEEECGKNGSDHVSQKNHGKQEKREPTGPQEPSYLRFIQSLAENTGSVTTDSTVTTSPYAFTQVTGPYNTFV |
| Purity : | > 85% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | Tet2 tet methylcytosine dioxygenase 2 [ Mus musculus ] |
| Official Symbol | TET2 |
| Synonyms | TET2; tet methylcytosine dioxygenase 2; tet oncogene 2; Ayu17-449; mKIAA1546; E130014J05Rik; MGC37385; |
| Gene ID | 214133 |
| mRNA Refseq | NM_001040400 |
| Protein Refseq | NP_001035490 |
| UniProt ID | Q4JK59 |
| ◆ Recombinant Proteins | ||
| TET2-5153C | Recombinant Chicken TET2 | +Inquiry |
| TET2-16653M | Recombinant Mouse TET2 Protein | +Inquiry |
| TET2-311H | Recombinant Human TET2 protein, His-tagged | +Inquiry |
| TET2-160H | Recombinant Human TET2, GST-tagged | +Inquiry |
| TET2-3184H | Recombinant Human TET2, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TET2 Products
Required fields are marked with *
My Review for All TET2 Products
Required fields are marked with *



