Recombinant Mouse THBS2 Protein (19-232 aa), His-tagged
Cat.No. : | THBS2-1539M |
Product Overview : | Recombinant Mouse THBS2 Protein (19-232 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Tag : | His |
Protein Length : | 19-232 aa |
Description : | Adhesive glycoprotein that mediates cell-to-cell and cell-to-matrix interactions. Ligand for CD36 mediating antiangiogenic properties. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 26.1 kDa |
AA Sequence : | GDHVKDTSFDLFSISNINRKTIGAKQFRGPDPGVPAYRFVRFDYIPPVNTDDLNRIVKLARRKEGFFLTAQLKQDRKSRGTLLVLEGPGTSQRQFEIVSNGPGDTLDLNYWVEGNQHTNFLEDVGLADSQWKNVTVQVASDTYSLYVGCDLIDSVTLEEPFYEQLEVDRSRMYVAKGASRESHFRGLLQNVHLVFADSVEDILSKKGCQHSQGA |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | Thbs2 thrombospondin 2 [ Mus musculus ] |
Official Symbol | THBS2 |
Synonyms | THBS2; thrombospondin 2; thrombospondin-2; TSP2; Thbs-2; |
Gene ID | 21826 |
mRNA Refseq | NM_011581 |
Protein Refseq | NP_035711 |
UniProt ID | Q03350 |
◆ Recombinant Proteins | ||
THBS2-6444H | Recombinant Human THBS2 Protein (Asp968-Ile1172), N-His tagged | +Inquiry |
THBS2-1151C | Recombinant Chicken THBS2 | +Inquiry |
THBS2-101H | Active Recombinant Human THBS2, His-tagged | +Inquiry |
THBS2-16737M | Recombinant Mouse THBS2 Protein | +Inquiry |
THBS2-830M | Recombinant Mouse THBS2 Protein (19-232 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
THBS2-1100HCL | Recombinant Human THBS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All THBS2 Products
Required fields are marked with *
My Review for All THBS2 Products
Required fields are marked with *
0
Inquiry Basket