Recombinant Mouse THBS2 Protein (19-232 aa), His-tagged

• Cat.No.: THBS2-1539M
• Product Overview: Recombinant Mouse THBS2 Protein (19-232 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.

Specification

• Species: Mouse
• Source: Yeast
• Tag: His
• Protein Length: 19-232 aa
• Description: Adhesive glycoprotein that mediates cell-to-cell and cell-to-matrix interactions. Ligand for CD36 mediating antiangiogenic properties.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 26.1 kDa
• AA Sequence: GDHVKDTSFDLFSISNINRKTIGAKQFRGPDPGVPAYRFVRFDYIPPVNTDDLNRIVKLARRKEGFFLTAQLKQDRKSRGTLLVLEGPGTSQRQFEIVSNGPGDTLDLNYWVEGNQHTNFLEDVGLADSQWKNVTVQVASDTYSLYVGCDLIDSVTLEEPFYEQLEVDRSRMYVAKGASRESHFRGLLQNVHLVFADSVEDILSKKGCQHSQGA
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: Thbs2 thrombospondin 2 [ Mus musculus ]
• Official Symbol: THBS2
• Synonyms: THBS2; thrombospondin 2; thrombospondin-2; TSP2; Thbs-2
• Gene ID: 21826
• mRNA Refseq: NM_011581
• Protein Refseq: NP_035711
• UniProt ID: Q03350