Recombinant Mouse Tnc protein, His&Myc-tagged
Cat.No. : | Tnc-2326M |
Product Overview : | Recombinant Mouse Tnc protein(Q80YX1)(1884-2099aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in Insect Cell. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Insect Cells |
Tag : | His&Myc |
Protein Length : | 1884-2099aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 28.8 kDa |
AA Sequence : | GLLYPFPRDCSQAMLNGDTTSGLYTIYINGDKTQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKAYAAGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDHGESAYAVYDRFSVGDAKSRYKLKVEGYSGTAGDSMNYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNNHSQGVNWFHWKGHEYSIQFAEMKLRPSN |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tnc tenascin C [ Mus musculus ] |
Official Symbol | Tnc |
Synonyms | TNC; tenascin C; tenascin; hexabrachion; TN; Hxb; Ten; TN-C; AI528729; cytotactin; tenascin-C; C130033P17Rik; MGC144208; MGC144209; |
Gene ID | 21923 |
mRNA Refseq | NM_011607 |
Protein Refseq | NP_035737 |
◆ Recombinant Proteins | ||
Tnc-2326M | Recombinant Mouse Tnc protein, His&Myc-tagged | +Inquiry |
TNC-7006C | Recombinant Chicken TNC | +Inquiry |
Tnc-6538M | Recombinant Mouse Tnc Protein, Myc/DDK-tagged | +Inquiry |
TNC-301211H | Recombinant Human TNC protein, GST-tagged | +Inquiry |
TNC-1082H | Recombinant Human TNC Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
TNC-50H | Native Human Tenascin C | +Inquiry |
TNC-08H | Native Human TNC Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tnc Products
Required fields are marked with *
My Review for All Tnc Products
Required fields are marked with *