Recombinant Mouse Tnf Protein

Cat.No. : Tnf-140M
Product Overview : Purified recombinant protein of Mouse tumor necrosis factor (Tnf) without tag was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : This gene encodes a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. Members of this family are classified based on primary sequence, function, and structure. This protein is synthesized as a type-II transmembrane protein and is reported to be cleaved into products that exert distinct biological functions. It plays an important role in the innate immune response as well as regulating homeostasis but is also implicated in diseases of chronic inflammation. In mouse deficiency of this gene is associated with defects in response to bacterial infection, with defects in forming organized follicular dendritic cell networks and germinal centers, and with a lack of primary B cell follicles. Alternative splicing results in multiple transcript variants.
Molecular Mass : 16.4 kDa
AA Sequence : MDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL
Endotoxin : Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Purity : >95%, as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Storage : Store at -80 centigrade.
Storage Buffer : Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name Tnf tumor necrosis factor [ Mus musculus (house mouse) ]
Official Symbol Tnf
Synonyms Tnf; tumor necrosis factor; DIF; Tnfa; TNF-a; TNFSF2; Tnlg1f; Tnfsf1a; TNFalpha; TNF-alpha; tumor necrosis factor; cachectin; tumor necrosis factor ligand 1f; tumor necrosis factor ligand superfamily member 2; tumor necrosis factor-alpha
Gene ID 21926
mRNA Refseq NM_013693
Protein Refseq NP_038721
UniProt ID P06804

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Tnf Products

Required fields are marked with *

My Review for All Tnf Products

Required fields are marked with *

0
cart-icon
0
compare icon