Recombinant Mouse Tnfrsf1a Protein

Cat.No. : Tnfrsf1a-141M
Product Overview : Purified recombinant protein of Mouse tumor necrosis factor receptor superfamily, member 1a (Tnfrsf1a) without tag was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : This gene encodes a member of the TNF receptor superfamily of proteins. The encoded receptor is found in membrane-bound and soluble forms that interact with membrane-bound and soluble forms, respectively, of its ligand, tumor necrosis factor alpha. Binding of membrane-bound tumor necrosis factor alpha to the membrane-bound receptor induces receptor trimerization and activation, which plays a role in cell survival, apoptosis, and inflammation. Proteolytic processing of the encoded receptor results in release of the soluble form of the receptor, which can interact with free tumor necrosis factor alpha to inhibit inflammation. Mice lacking a functional copy of this gene exhibit impaired immune function.
Molecular Mass : 21.2 kDa
AA Sequence : MIHPSGVTGLVPSLGDREKRDSLCPQGKYVHSKNNSICCTKCHKGTYLVSDCPSPGRDTVCRECEKGTFTASQNYLRQCLSCKTCRKEMSQVEISPCQADKDTVCGCKENQFQRYLSETHFQCVDCSPCFNGTVTIPCKETQNTVCNCHAGFFLRESECVPCSHCKKNEECMKLCLPPPLANVTNPQDSGTA
Endotoxin : Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Purity : >95%, as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Storage : Store at -80 centigrade.
Storage Buffer : Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name Tnfrsf1a tumor necrosis factor receptor superfamily, member 1a [ Mus musculus (house mouse) ]
Official Symbol Tnfrsf1a
Synonyms Tnfrsf1a; tumor necrosis factor receptor superfamily, member 1a; FPF; p55; TNF-R; TNFAR; TNFRI; Tnfr1; p55-R; CD120a; TNF-R1; TNFR60; Tnfr-2; TNF-R-I; TNF-R55; TNFRp55; TNF-alphaR1; TNFalpha-R1; tumor necrosis factor receptor superfamily member 1A; TNF receptor alpha chain; TNF-RI; TNF-alpha-R1; TNFR-I; p60; tumor necrosis factor receptor 1; tumor necrosis factor receptor type I
Gene ID 21937
mRNA Refseq NM_011609
Protein Refseq NP_035739
UniProt ID P25118

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Tnfrsf1a Products

Required fields are marked with *

My Review for All Tnfrsf1a Products

Required fields are marked with *

0
cart-icon
0
compare icon