Recombinant Mouse Tnfrsf1a Protein
| Cat.No. : | Tnfrsf1a-141M |
| Product Overview : | Purified recombinant protein of Mouse tumor necrosis factor receptor superfamily, member 1a (Tnfrsf1a) without tag was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Description : | This gene encodes a member of the TNF receptor superfamily of proteins. The encoded receptor is found in membrane-bound and soluble forms that interact with membrane-bound and soluble forms, respectively, of its ligand, tumor necrosis factor alpha. Binding of membrane-bound tumor necrosis factor alpha to the membrane-bound receptor induces receptor trimerization and activation, which plays a role in cell survival, apoptosis, and inflammation. Proteolytic processing of the encoded receptor results in release of the soluble form of the receptor, which can interact with free tumor necrosis factor alpha to inhibit inflammation. Mice lacking a functional copy of this gene exhibit impaired immune function. |
| Molecular Mass : | 21.2 kDa |
| AA Sequence : | MIHPSGVTGLVPSLGDREKRDSLCPQGKYVHSKNNSICCTKCHKGTYLVSDCPSPGRDTVCRECEKGTFTASQNYLRQCLSCKTCRKEMSQVEISPCQADKDTVCGCKENQFQRYLSETHFQCVDCSPCFNGTVTIPCKETQNTVCNCHAGFFLRESECVPCSHCKKNEECMKLCLPPPLANVTNPQDSGTA |
| Endotoxin : | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
| Purity : | >95%, as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. |
| Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4 |
| Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Gene Name | Tnfrsf1a tumor necrosis factor receptor superfamily, member 1a [ Mus musculus (house mouse) ] |
| Official Symbol | Tnfrsf1a |
| Synonyms | Tnfrsf1a; tumor necrosis factor receptor superfamily, member 1a; FPF; p55; TNF-R; TNFAR; TNFRI; Tnfr1; p55-R; CD120a; TNF-R1; TNFR60; Tnfr-2; TNF-R-I; TNF-R55; TNFRp55; TNF-alphaR1; TNFalpha-R1; tumor necrosis factor receptor superfamily member 1A; TNF receptor alpha chain; TNF-RI; TNF-alpha-R1; TNFR-I; p60; tumor necrosis factor receptor 1; tumor necrosis factor receptor type I |
| Gene ID | 21937 |
| mRNA Refseq | NM_011609 |
| Protein Refseq | NP_035739 |
| UniProt ID | P25118 |
| ◆ Recombinant Proteins | ||
| TNFRSF1A-3189H | Active Recombinant Human TNFRSF1A protein, His-tagged | +Inquiry |
| TNFRSF1A-4634H | Recombinant Human TNFRSF1A protein, His-tagged | +Inquiry |
| Tnfrsf1a-10624M | Recombinant Mouse Tnfrsf1a Protein, His (Fc)-Avi-tagged | +Inquiry |
| TNFRSF1A-5235H | Recombinant Human TNFRSF1A protein, GST-tagged | +Inquiry |
| TNFRSF1A-5535H | Recombinant Human TNFRSF1A protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TNFRSF1A-1084RCL | Recombinant Rat TNFRSF1A cell lysate | +Inquiry |
| TNFRSF1A-1693MCL | Recombinant Mouse TNFRSF1A cell lysate | +Inquiry |
| TNFRSF1A-2390HCL | Recombinant Human TNFRSF1A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tnfrsf1a Products
Required fields are marked with *
My Review for All Tnfrsf1a Products
Required fields are marked with *
