Recombinant Mouse Tnfrsf1b protein

Cat.No. : Tnfrsf1b-847M
Product Overview : Recombinant Mouse Tnfrsf1b protein was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : Non
Protein Length : 236
Description : Receptor with high affinity for TNFSF2/TNF-alpha and approximately 5-fold lower affinity for homotrimeric TNFSF1/lymphotoxin-alpha. The TRAF1/TRAF2 complex recruits the apoptotic suppressors BIRC2 and BIRC3 to TNFRSF1B/TNFR2 (By similarity).
Form : Lyophilized from a 0.2 µm filtered solution in PBS, pH 7.4.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by its ability to inhibit the TNF-α mediated cytotoxicity in the L-929 cells is less than 2 μg/ml, corresponding to a specific activity of > 500 IU/mg in the presence of 0.1 ng/mL of rMuTNF-α.
Molecular Mass : Approximately 25.3 kDa, a single non-glycosylated polypeptide chain containing 236 amino acids.
AA Sequence : VPAQVVLTPYKPEPGYECQISQEYYDRKAQMCCAKCPPGQYVKHFCNKTSDTVCADCEASMYTQVWNQFRTCLSCSSSCTTDQVEIRACTKQQNRVCACEAGRYCALKTHSGSCRQCMRLSKCGPGFGVASSRAPNGNVLCKACAPGTFSDTTSSTDVCRPHRICSILAIPGNASTDAVCAPESPTLSAIPRTLYVSQPEPTRSQPLDQEPGPSQTPSILTSLGSTPIIEQSTKGG
Endotoxin : Less than 0.1 EU/µg of rMusTNF RII/TNFRSF1B as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analyses.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name Tnfrsf1b
Official Symbol Tnfrsf1b
Synonyms TNFRSF1B; tumor necrosis factor receptor superfamily, member 1b; tumor necrosis factor receptor superfamily member 1B; TNF-RII; TNFR-II; p75 TNFR; p80 TNF-alpha receptor; TNF receptor beta chain; tumor necrosis factor receptor 2; tumor necrosis factor receptor type II; p75; TNFBR; Tnfr2; CD120b; TNF-R2; TNFR80; TNFRII; Tnfr-1; TNF-R75; TNF-R-II; TNF-alphaR2; TNFalpha-R2;
Gene ID 21938
mRNA Refseq NM_011610
Protein Refseq NP_035740
UniProt ID P25119

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Tnfrsf1b Products

Required fields are marked with *

My Review for All Tnfrsf1b Products

Required fields are marked with *

0

Inquiry Basket

cartIcon