Recombinant Mouse Tnfrsf1b protein
Cat.No. : | Tnfrsf1b-847M |
Product Overview : | Recombinant Mouse Tnfrsf1b protein was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | Non |
Protein Length : | 236 |
Description : | Receptor with high affinity for TNFSF2/TNF-alpha and approximately 5-fold lower affinity for homotrimeric TNFSF1/lymphotoxin-alpha. The TRAF1/TRAF2 complex recruits the apoptotic suppressors BIRC2 and BIRC3 to TNFRSF1B/TNFR2 (By similarity). |
Form : | Lyophilized from a 0.2 µm filtered solution in PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by its ability to inhibit the TNF-α mediated cytotoxicity in the L-929 cells is less than 2 μg/ml, corresponding to a specific activity of > 500 IU/mg in the presence of 0.1 ng/mL of rMuTNF-α. |
Molecular Mass : | Approximately 25.3 kDa, a single non-glycosylated polypeptide chain containing 236 amino acids. |
AA Sequence : | VPAQVVLTPYKPEPGYECQISQEYYDRKAQMCCAKCPPGQYVKHFCNKTSDTVCADCEASMYTQVWNQFRTCLSCSSSCTTDQVEIRACTKQQNRVCACEAGRYCALKTHSGSCRQCMRLSKCGPGFGVASSRAPNGNVLCKACAPGTFSDTTSSTDVCRPHRICSILAIPGNASTDAVCAPESPTLSAIPRTLYVSQPEPTRSQPLDQEPGPSQTPSILTSLGSTPIIEQSTKGG |
Endotoxin : | Less than 0.1 EU/µg of rMusTNF RII/TNFRSF1B as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analyses. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Tnfrsf1b |
Official Symbol | Tnfrsf1b |
Synonyms | TNFRSF1B; tumor necrosis factor receptor superfamily, member 1b; tumor necrosis factor receptor superfamily member 1B; TNF-RII; TNFR-II; p75 TNFR; p80 TNF-alpha receptor; TNF receptor beta chain; tumor necrosis factor receptor 2; tumor necrosis factor receptor type II; p75; TNFBR; Tnfr2; CD120b; TNF-R2; TNFR80; TNFRII; Tnfr-1; TNF-R75; TNF-R-II; TNF-alphaR2; TNFalpha-R2; |
Gene ID | 21938 |
mRNA Refseq | NM_011610 |
Protein Refseq | NP_035740 |
UniProt ID | P25119 |
◆ Recombinant Proteins | ||
TNFRSF1B-482R | Recombinant Rhesus Macaque TNFRSF1B(Leu23-Asp257) Protein, C-6*His-tagged | +Inquiry |
TNFRSF1B-211H | Recombinant Human TNFRSF1B Protein, His (Fc)-Avi-tagged | +Inquiry |
TNFRSF1B-5270H | Recombinant Human TNFRSF1B protein | +Inquiry |
TNFRSF1B-165H | Active Recombinant Human TNFRSF1B, Fc Chimera | +Inquiry |
TNFRSF1B-62H | Recombinant Human TNFRSF1B protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF1B-2632HCL | Recombinant Human TNFRSF1B cell lysate | +Inquiry |
TNFRSF1B-1048CCL | Recombinant Cynomolgus TNFRSF1B cell lysate | +Inquiry |
TNFRSF1B-2192MCL | Recombinant Mouse TNFRSF1B cell lysate | +Inquiry |
TNFRSF1B-851HCL | Recombinant Human TNFRSF1B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Tnfrsf1b Products
Required fields are marked with *
My Review for All Tnfrsf1b Products
Required fields are marked with *
0
Inquiry Basket