Recombinant Mouse TNFRSF4 Protein
Cat.No. : | TNFRSF4-686M |
Product Overview : | Recombinant Mouse TNFRSF4 protein without tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | HEK293 |
Protein Length : | 272 |
Description : | Enables tumor necrosis factor-activated receptor activity. Involved in negative regulation of apoptotic process; positive regulation of B cell proliferation; and regulation of gene expression. Acts upstream of or within several processes, including cellular defense response; negative regulation of cytokine production; and regulation of protein kinase activity. Located in external side of plasma membrane. Human ortholog(s) of this gene implicated in immunodeficiency 16. Orthologous to human TNFRSF4 (TNF receptor superfamily member 4). |
Form : | Lyophilized |
Molecular Mass : | 22.1 kDa |
AA Sequence : | MYVWVQQPTALLLLALTLGVTARRLNCVKHTYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWETQRPTFRPTTVQSTTVWPRTSELPSPPTLVTPEGPAFAVLLGLGLGLLAPLTVLLALYLLRKAWRLPNTPKPCWGNSFRTPIQEEHTDAHFTLAKI |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | Tnfrsf4 tumor necrosis factor receptor superfamily, member 4 [ Mus musculus (house mouse) ] |
Official Symbol | TNFRSF4 |
Synonyms | TNFRSF4; tumor necrosis factor receptor superfamily, member 4; tumor necrosis factor receptor superfamily member 4; OX40 antigen; OX40L receptor; tax-transcriptionally activated glycoprotein 1; Ox40; ACT35; CD134; Ly-70; Txgp1; TXGP1L; |
Gene ID | 22163 |
mRNA Refseq | NM_011659 |
Protein Refseq | NP_035789 |
UniProt ID | P47741 |
◆ Recombinant Proteins | ||
TNFRSF4-393H | Active Recombinant Human TNFRSF4 Protein (Met1-Ala216), His-tagged, Biotinylated | +Inquiry |
Tnfrsf4-7400MF | Recombinant Mouse Tnfrsf4 Protein, hFc-tagged, FITC conjugated | +Inquiry |
TNFRSF4-102M | Recombinant Rhesus macaque TNFRSF4 protein, Fc-tagged | +Inquiry |
TNFRSF4-521H | Active Recombinant Human TNFRSF4, HIgG1 Fc-tagged | +Inquiry |
Tnfrsf4-547MF | Recombinant Mouse Tnfrsf4 Protein, FITC conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF4-2422HCL | Recombinant Human TNFRSF4 cell lysate | +Inquiry |
TNFRSF4-1762MCL | Recombinant Mouse TNFRSF4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNFRSF4 Products
Required fields are marked with *
My Review for All TNFRSF4 Products
Required fields are marked with *
0
Inquiry Basket