Recombinant Mouse TNFRSF9 Protein
| Cat.No. : | TNFRSF9-582M |
| Product Overview : | Recombinant Mouse TNFRSF9 protein without tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | HEK293 |
| Protein Length : | 211 |
| Description : | Enables cytokine binding activity; identical protein binding activity; and signaling receptor activity. Acts upstream of or within negative regulation of interleukin-10 production; negative regulation of interleukin-12 production; and regulation of cell population proliferation. Located in external side of plasma membrane and extracellular space. Is expressed in renal vasculature. Orthologous to human TNFRSF9 (TNF receptor superfamily member 9). |
| Form : | Lyophilized |
| Molecular Mass : | 22 kDa |
| AA Sequence : | MGNNCYNVVVIVLLLVGCEKVGAVQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPAFKKTTGAAQEEDACSCRCPQEEEGGGGGYEL |
| Purity : | > 98% |
| Applications : | WB; ELISA; FACS; FC |
| Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
| Storage : | At -20 centigrade. |
| Concentration : | 1 mg/mL |
| Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
| Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
| Gene Name | Tnfrsf9 tumor necrosis factor receptor superfamily, member 9 [ Mus musculus (house mouse) ] |
| Official Symbol | TNFRSF9 |
| Synonyms | TNFRSF9; tumor necrosis factor receptor superfamily, member 9; tumor necrosis factor receptor superfamily member 9; CD137 antigen; T-cell antigen 4-1BB; 4-1BB ligand receptor; secreted CD137 antigen; ILA; Ly63; 4-1BB; Cd137; CDw137; AA408498; AI325004; A930040I11Rik; |
| Gene ID | 21942 |
| mRNA Refseq | NM_001077508 |
| Protein Refseq | NP_001070976 |
| UniProt ID | P20334 |
| ◆ Recombinant Proteins | ||
| TNFRSF9-0243M | Active Recombinant Mouse TNFRSF9 protein, His-tagged | +Inquiry |
| TNFRSF9-191C | Active Recombinant Cynomolgus TNFRSF9 protein, hFc-tagged | +Inquiry |
| TNFRSF9-348M | Recombinant Mouse TNFRSF9 protein, His-tagged | +Inquiry |
| TNFRSF9-581H | Active Recombinant Human TNFRSF9, Fc-His-tagged | +Inquiry |
| TNFRSF9-4870R | Recombinant Rhesus monkey TNFRSF9 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TNFRSF9-928CCL | Recombinant Canine TNFRSF9 cell lysate | +Inquiry |
| TNFRSF9-2162HCL | Recombinant Human TNFRSF9 cell lysate | +Inquiry |
| TNFRSF9-1792MCL | Recombinant Mouse TNFRSF9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFRSF9 Products
Required fields are marked with *
My Review for All TNFRSF9 Products
Required fields are marked with *
