Recombinant Mouse Tnfsf14 Protein

Cat.No. : Tnfsf14-147M
Product Overview : Purified recombinant protein of Mouse tumor necrosis factor (ligand) superfamily, member 14 (Tnfsf14) without tag was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : Cytokine that binds to TNFRSF3/LTBR. Binding to the decoy receptor TNFRSF6B modulates its effects. Activates NFKB and stimulates the proliferation of T-cells.
Molecular Mass : 20.1 kDa
AA Sequence : MRLHQRLGDIVAHLPDGGKGSWEKLIQDQRSHQANPAAHLTGANASLIGIGGPLLWETRLGLAFLRGLTYHDGALVTMEPGYYYVYSKVQLSGVGCPQGLANGLPITHGLYKRTSRYPKELELLVSRRSPCGRANSSRVWWDSSFLGGVVHLEAGEEVVVRVPGNRLVRPRDGTRSYFGAFMV
Endotoxin : Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Purity : >95%, as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Storage : Store at -80 centigrade.
Storage Buffer : Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Reconstitution : Resuspend the protein in the desired concentration in proper buffer.
Gene Name Tnfsf14 tumor necrosis factor (ligand) superfamily, member 14 [ Mus musculus (house mouse) ]
Official Symbol Tnfsf14
Synonyms Tnfsf14; tumor necrosis factor (ligand) superfamily, member 14; LTg; HVEML; LIGHT; Ly113; HVEM-L; Tnlg1d;
Gene ID 50930
mRNA Refseq NM_019418
Protein Refseq NP_062291
UniProt ID Q9QYH9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Tnfsf14 Products

Required fields are marked with *

My Review for All Tnfsf14 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon