Recombinant Mouse Tnfsf14 Protein
| Cat.No. : | Tnfsf14-147M |
| Product Overview : | Purified recombinant protein of Mouse tumor necrosis factor (ligand) superfamily, member 14 (Tnfsf14) without tag was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Description : | Cytokine that binds to TNFRSF3/LTBR. Binding to the decoy receptor TNFRSF6B modulates its effects. Activates NFKB and stimulates the proliferation of T-cells. |
| Molecular Mass : | 20.1 kDa |
| AA Sequence : | MRLHQRLGDIVAHLPDGGKGSWEKLIQDQRSHQANPAAHLTGANASLIGIGGPLLWETRLGLAFLRGLTYHDGALVTMEPGYYYVYSKVQLSGVGCPQGLANGLPITHGLYKRTSRYPKELELLVSRRSPCGRANSSRVWWDSSFLGGVVHLEAGEEVVVRVPGNRLVRPRDGTRSYFGAFMV |
| Endotoxin : | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
| Purity : | >95%, as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. |
| Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
| Reconstitution : | Resuspend the protein in the desired concentration in proper buffer. |
| Gene Name | Tnfsf14 tumor necrosis factor (ligand) superfamily, member 14 [ Mus musculus (house mouse) ] |
| Official Symbol | Tnfsf14 |
| Synonyms | Tnfsf14; tumor necrosis factor (ligand) superfamily, member 14; LTg; HVEML; LIGHT; Ly113; HVEM-L; Tnlg1d; |
| Gene ID | 50930 |
| mRNA Refseq | NM_019418 |
| Protein Refseq | NP_062291 |
| UniProt ID | Q9QYH9 |
| ◆ Recombinant Proteins | ||
| Tnfsf14-948M | Recombinant Mouse Tnfsf14 | +Inquiry |
| Tnfsf14-7783M | Recombinant Mouse Tnfsf14 protein, His & S-tagged | +Inquiry |
| TNFSF14-0342H | Active Recombinant Human TNFSF14 protein, Fc-tagged | +Inquiry |
| TNFSF14-552HAF647 | Recombinant Human TNFSF14 Protein, hFc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
| TNFSF14-5236H | Recombinant Human TNFSF14 Protein (Leu59-Val240), N-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TNFSF14-891HCL | Recombinant Human TNFSF14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tnfsf14 Products
Required fields are marked with *
My Review for All Tnfsf14 Products
Required fields are marked with *
