Recombinant Mouse Tnfsf14 Protein

• Cat.No.: Tnfsf14-147M
• Product Overview: Purified recombinant protein of Mouse tumor necrosis factor (ligand) superfamily, member 14 (Tnfsf14) without tag was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Description: Cytokine that binds to TNFRSF3/LTBR. Binding to the decoy receptor TNFRSF6B modulates its effects. Activates NFKB and stimulates the proliferation of T-cells.
• Molecular Mass: 20.1 kDa
• AA Sequence: MRLHQRLGDIVAHLPDGGKGSWEKLIQDQRSHQANPAAHLTGANASLIGIGGPLLWETRLGLAFLRGLTYHDGALVTMEPGYYYVYSKVQLSGVGCPQGLANGLPITHGLYKRTSRYPKELELLVSRRSPCGRANSSRVWWDSSFLGGVVHLEAGEEVVVRVPGNRLVRPRDGTRSYFGAFMV
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Purity: >95%, as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.
• Storage: Store at -80 centigrade.
• Storage Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Reconstitution: Resuspend the protein in the desired concentration in proper buffer.

Gene Information

• Gene Name: Tnfsf14 tumor necrosis factor (ligand) superfamily, member 14 [ Mus musculus (house mouse) ]
• Official Symbol: Tnfsf14
• Synonyms: Tnfsf14; tumor necrosis factor (ligand) superfamily, member 14; LTg; HVEML; LIGHT; Ly113; HVEM-L; Tnlg1d
• Gene ID: 50930
• mRNA Refseq: NM_019418
• Protein Refseq: NP_062291
• UniProt ID: Q9QYH9