Recombinant Mouse Tnfsf15 Protein, His-tagged

Cat.No. : Tnfsf15-124M
Product Overview : Recombinant Mouse Tnfsf15 Protein, fused to His-tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Description : Predicted to enable death receptor binding activity. Predicted to be involved in activation of cysteine-type endopeptidase activity involved in apoptotic process and positive regulation of cytokine production. Predicted to act upstream of or within activation of NF-kappaB-inducing kinase activity. Predicted to be located in plasma membrane. Used to study inflammatory bowel disease 16. Orthologous to human TNFSF15 (TNF superfamily member 15).
Form : 50mM Tris, 0.3 M NaCl, pH 8.0.
Molecular Mass : 21.7 kDa
AA Sequence : MHHHHHHENLYFQGITEERSEPSPQQVYSPPRGKPRAHLTIKKQTPAPHLKNQLSALHWEHDLGMAFTKNGMKYINKSLVIPESGDYFIYSQITFRGTTSVCGDISRGRRPNKPDSITVVITKVADSYPEPARLLTGSKSVCEISNNWFQSLYLGAMFSLEEGDRLMVNVSDISLVDYTKEDKTFFGAFLL
Endotoxin : <1EU/ug
Purity : >90%
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.9 mg/ml
Gene Name Tnfsf15 tumor necrosis factor (ligand) superfamily, member 15 [ Mus musculus (house mouse) ]
Official Symbol Tnfsf15
Synonyms Tl1; Tl1a; Vegi; Tnlg1b
Gene ID 326623
mRNA Refseq NM_177371
Protein Refseq NP_796345
UniProt ID Q5UBV8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Tnfsf15 Products

Required fields are marked with *

My Review for All Tnfsf15 Products

Required fields are marked with *

0
cart-icon
0
compare icon