Recombinant Mouse Tnfsf15 Protein, His-tagged
| Cat.No. : | Tnfsf15-124M |
| Product Overview : | Recombinant Mouse Tnfsf15 Protein, fused to His-tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Description : | Predicted to enable death receptor binding activity. Predicted to be involved in activation of cysteine-type endopeptidase activity involved in apoptotic process and positive regulation of cytokine production. Predicted to act upstream of or within activation of NF-kappaB-inducing kinase activity. Predicted to be located in plasma membrane. Used to study inflammatory bowel disease 16. Orthologous to human TNFSF15 (TNF superfamily member 15). |
| Form : | 50mM Tris, 0.3 M NaCl, pH 8.0. |
| Molecular Mass : | 21.7 kDa |
| AA Sequence : | MHHHHHHENLYFQGITEERSEPSPQQVYSPPRGKPRAHLTIKKQTPAPHLKNQLSALHWEHDLGMAFTKNGMKYINKSLVIPESGDYFIYSQITFRGTTSVCGDISRGRRPNKPDSITVVITKVADSYPEPARLLTGSKSVCEISNNWFQSLYLGAMFSLEEGDRLMVNVSDISLVDYTKEDKTFFGAFLL |
| Endotoxin : | <1EU/ug |
| Purity : | >90% |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.9 mg/ml |
| Gene Name | Tnfsf15 tumor necrosis factor (ligand) superfamily, member 15 [ Mus musculus (house mouse) ] |
| Official Symbol | Tnfsf15 |
| Synonyms | Tl1; Tl1a; Vegi; Tnlg1b |
| Gene ID | 326623 |
| mRNA Refseq | NM_177371 |
| Protein Refseq | NP_796345 |
| UniProt ID | Q5UBV8 |
| ◆ Recombinant Proteins | ||
| TNFSF15-1071H | Active Recombinant Human TNFSF15 protein | +Inquiry |
| TNFSF15-151H | Recombinant Human TNFSF15 Protein, DYKDDDDK-tagged | +Inquiry |
| TNFSF15-150HB | Recombinant Human TNFSF15 Trimer protein, N-His-Flag-tagged, Biotinylated | +Inquiry |
| TNFSF15-6718H | Recombinant Human TNFSF15 Protein (Leu72-Leu251), His tagged | +Inquiry |
| TNFSF15-0743H | Active Recombinant Human TNFSF15 protein, His-Avi-tagged, Biotinylated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TNFSF15-1386RCL | Recombinant Rat TNFSF15 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tnfsf15 Products
Required fields are marked with *
My Review for All Tnfsf15 Products
Required fields are marked with *
