Recombinant Mouse TNFSF4 Protein, Fc-tagged

Cat.No. : TNFSF4-690M
Product Overview : Recombinant Mouse TNFSF4 protein with Fc tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : HEK293
Tag : Fc
Protein Length : 198
Description : Enables tumor necrosis factor receptor binding activity. Involved in several processes, including T cell activation; regulation of gene expression; and regulation of lymphocyte activation. Acts upstream of or within cholesterol metabolic process; inflammatory response; and negative regulation of cytokine production. Predicted to be located in cell surface. Predicted to be active in extracellular space. Is expressed in sensory organ and skeleton. Used to study primary pulmonary hypertension and type 1 diabetes mellitus. Human ortholog(s) of this gene implicated in myocardial infarction. Orthologous to human TNFSF4 (TNF superfamily member 4).
Form : Lyophilized
Molecular Mass : 44.5 kDa
AA Sequence : MEGEGVQPLDENLENGSRPRFKWKKTLRLVVSGIKGAGMLLCFIYVCLQLSSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHSTVNQVPL
Purity : > 98%
Applications : WB; ELISA; FACS; FC
Stability : This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage : At -20 centigrade.
Concentration : 1 mg/mL
Storage Buffer : PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
Reconstitution : Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.
Gene Name Tnfsf4 tumor necrosis factor (ligand) superfamily, member 4 [ Mus musculus (house mouse) ]
Official Symbol TNFSF4
Synonyms TNFSF4; tumor necrosis factor (ligand) superfamily, member 4; tumor necrosis factor ligand superfamily member 4; OX40 ligand; atherosclerosis 1; tax-transcriptionally activated glycoprotein 1 ligand; Ath1; gp34; Ath-1; Ox40l; TXGP1; CD134L; OX-40L; Txgp1l;
Gene ID 22164
mRNA Refseq NM_009452
Protein Refseq NP_033478
UniProt ID P43488

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNFSF4 Products

Required fields are marked with *

My Review for All TNFSF4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon