Recombinant Mouse Tpp2 protein, His&Myc-tagged
Cat.No. : | Tpp2-4607M |
Product Overview : | Recombinant Mouse Tpp2 protein(Q64514)(44-264aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 44-264aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 29.5 kDa |
AA Sequence : | DTGVDPGAPGMQVTTDGKPKIIDIIDTTGSGDVNTATEVEPKDGEIIGLSGRVLKIPANWTNPLGKYHIGIKNGYDFYPKALKERIQKERKEKIWDPIHRVALAEACRKQEEFDIANNGSSQANKLIKEELQSQVELLNSFEKKYSDPGPVYDCLVWHDGETWRACVDSNENGDLSKCAVLRNYKEAQEYSSFGTAEMLNYSVNIYDDGNLLSIVTSGGAH |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | Tpp2 tripeptidyl peptidase II [ Mus musculus ] |
Official Symbol | Tpp2 |
Synonyms | TPP2; tripeptidyl peptidase II; tripeptidyl-peptidase 2; TPP-II; tripeptidyl-peptidase II; tripeptidyl aminopeptidase; TPP-2; TppII; |
Gene ID | 22019 |
mRNA Refseq | NM_009418 |
Protein Refseq | NP_033444 |
◆ Recombinant Proteins | ||
TPP2-17263M | Recombinant Mouse TPP2 Protein | +Inquiry |
TPP2-5903R | Recombinant Rat TPP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
TPP2-6246R | Recombinant Rat TPP2 Protein | +Inquiry |
TPP2-4606H | Recombinant Human TPP2 protein, His&Myc-tagged | +Inquiry |
TPP2-2242H | Recombinant Human TPP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TPP2-840HCL | Recombinant Human TPP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tpp2 Products
Required fields are marked with *
My Review for All Tpp2 Products
Required fields are marked with *