Recombinant Mouse Tpp2 protein, His&Myc-tagged
| Cat.No. : | Tpp2-4608M |
| Product Overview : | Recombinant Mouse Tpp2 protein(Q64514)(44-264aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in Insect cell. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | Insect Cells |
| Tag : | His&Myc |
| Protein Length : | 44-264aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 28.3 kDa |
| AA Sequence : | DTGVDPGAPGMQVTTDGKPKIIDIIDTTGSGDVNTATEVEPKDGEIIGLSGRVLKIPANWTNPLGKYHIGIKNGYDFYPKALKERIQKERKEKIWDPIHRVALAEACRKQEEFDIANNGSSQANKLIKEELQSQVELLNSFEKKYSDPGPVYDCLVWHDGETWRACVDSNENGDLSKCAVLRNYKEAQEYSSFGTAEMLNYSVNIYDDGNLLSIVTSGGAH |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Gene Name | Tpp2 tripeptidyl peptidase II [ Mus musculus ] |
| Official Symbol | Tpp2 |
| Synonyms | TPP2; tripeptidyl peptidase II; tripeptidyl-peptidase 2; TPP-II; tripeptidyl-peptidase II; tripeptidyl aminopeptidase; TPP-2; TppII; |
| Gene ID | 22019 |
| mRNA Refseq | NM_009418 |
| Protein Refseq | NP_033444 |
| ◆ Recombinant Proteins | ||
| TPP2-2242H | Recombinant Human TPP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TPP2-4606H | Recombinant Human TPP2 protein, His&Myc-tagged | +Inquiry |
| TPP2-6449H | Recombinant Human TPP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| TPP2-4609H | Recombinant Human TPP2 protein, His&Myc-tagged | +Inquiry |
| Tpp2-6604M | Recombinant Mouse Tpp2 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TPP2-840HCL | Recombinant Human TPP2 293 Cell Lysate | +Inquiry |
| TPP2-453HKCL | Human TPP2 Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tpp2 Products
Required fields are marked with *
My Review for All Tpp2 Products
Required fields are marked with *
