Recombinant Mouse Trbv13-2 Protein, GST-tagged
| Cat.No. : | Trbv13-2-27M |
| Product Overview : | Recombinant Mouse Recombinant Mouse Trbv13-2 Protein, fused to GST-tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | GST |
| Description : | Acts upstream of or within cytokine-mediated signaling pathway. |
| Form : | Supplied as a 0.2 μm filtered solution in 30mM Tris,300 mM NaCl,10% Glycerol, pH10.0. |
| Molecular Mass : | ~38.4 kDa |
| AA Sequence : | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSEAVVTQSPRNKVAVTGEKVTLSKQTNSYFNNMYWYRQDTGHELRLIFMSHGIRNVEKGDIPDGYKASRPSQENFSLILELATPSQTSVYFCASGGGGTLYFGAGTRLSVL |
| Purity : | >90% |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.19 mg/ml |
| Gene Name | Trbv13-2 T cell receptor beta, variable 13-2 [ Mus musculus (house mouse) ] |
| Official Symbol | Trbv13-2 |
| Synonyms | Tcrb; TCRBV8S2; Tcrb-V8.2 |
| Gene ID | 100124675 |
| UniProt ID | P04213 |
| ◆ Recombinant Proteins | ||
| Trbv13-2-27M | Recombinant Mouse Trbv13-2 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Trbv13-2 Products
Required fields are marked with *
My Review for All Trbv13-2 Products
Required fields are marked with *



