Recombinant Mouse Trem1 protein, His-tagged
Cat.No. : | Trem1-17319M |
Product Overview : | Recombinant Mouse Trem1(Ala21-Ser202) fused with 10-his tag at C-terminal was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | HEK293 |
Tag : | His |
Protein Length : | Ala21-Ser202 |
Description : | Triggering Receptor Expressed on Myeloid Cells 1 (TREM-1) is a transmembrane protein with a single Ig-like domain. TREM-1 associates with the adapter protein, DAP12, to deliver an activating signal. TREM-1 is expressed on blood neutrophils and monocytes, and the expression is up-regulated by bacterial LPS. TREM-1 is expressed at high levels on neutrophils of patients with microbial sepsis and in mice with a TREM-1/Fc fusion protein protected mice against LPS-induced shock. It stimulates neutrophil and monocyte-mediated inflammatory responses. Triggers release of pro-inflammatory chemokines and cytokines, as well as increased surface expression of cell activation markers. TREM-1 is amplifier of inflammatory responses that are triggered by bacterial and fungal infections and are a crucial mediator of septic shock. |
Form : | Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4. |
AA Sequence : | AIVLEEERYDLVEGQTLTVKCPFNIMKYANSQKAWQRLPDGKEPLTLVVTQRPFTRPSEVHMGKF TLKHDPSEAMLQVQMTDLQVTDSGLYRCVIYHPPNDPVVLFHPVRLVVTKGSSDVFTPVIIPITR LTERPILITTKYSPSDTTTTRSLPKPTAVVSSPGLGVTIINGTDADSVSTSSHHHHHH |
Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Storage : | Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days. Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months. |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Shipping : | The product is shipped at ambient temperature. |
Gene Name | Trem1 triggering receptor expressed on myeloid cells 1 [ Mus musculus ] |
Official Symbol | Trem1 |
Synonyms | TREM1; triggering receptor expressed on myeloid cells 1; triggering receptor expressed in monocytes 1; |
Gene ID | 58217 |
mRNA Refseq | NM_021406 |
Protein Refseq | NP_067381 |
UniProt ID | Q9JKE2 |
Chromosome Location | 17; 17 C |
Pathway | Cell surface interactions at the vascular wall, organism-specific biosystem; Hemostasis, organism-specific biosystem; |
Function | receptor activity; |
◆ Recombinant Proteins | ||
TREM1-886H | Recombinant Human TREM1 protein(Met1-Arg200), His&hFc-tagged | +Inquiry |
Trem1-17319M | Recombinant Mouse Trem1 protein, His-tagged | +Inquiry |
TREM1-7203H | Recombinant Human Triggering Receptor Expressed On Myeloid Cells 1, His-tagged | +Inquiry |
TREM1-5928H | Recombinant Human TREM1 Protein (Ala21-Asn205), His tagged | +Inquiry |
TREM1-214P | Recombinant Pig TREM1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TREM1-2140HCL | Recombinant Human TREM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Trem1 Products
Required fields are marked with *
My Review for All Trem1 Products
Required fields are marked with *