Recombinant Mouse Trim21 protein, His-SUMO-tagged
Cat.No. : | Trim21-4539M |
Product Overview : | Recombinant Mouse Trim21 protein(Q62191)(1-470aa), fused to N-terminal His-SUMO tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-470aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 70.2 kDa |
AA Sequence : | MSPSTTSKMSLEKMWEEVTCSICLDPMVEPMSIECGHCFCKECIFEVGKNGGSSCPECRQQFLLRNLRPNRHIANMVENLKQIAQNTKKSTQETHCMKHGEKLHLFCEEDGQALCWVCAQSGKHRDHTRVPIEEAAKVYQEKIHVVLEKLRKGKELAEKMEMDLTMQRTDWKRNIDTQKSRIHAEFALQNSLLAQEEQRQLQRLEKDQREYLRLLGKKEAELAEKNQALQELISELERRIRGSELELLQEVRIILERSGSWNLDTLDIDAPDLTSTCPVPGRKKMLRTCWVHITLDRNTANSWLIISKDRRQVRMGDTHQNVSDNKERFSNYPMVLGAQRFSSGKMYWEVDVTQKEAWDLGVCRDSVQRKGQFSLSPENGFWTIWLWQDSYEAGTSPQTTLHIQVPPCQIGIFVDYEAGVVSFYNITDHGSLIYTFSECVFAGPLRPFFNVGFNYSGGNAAPLKLCPLKM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Trim21 tripartite motif-containing 21 [ Mus musculus ] |
Official Symbol | Trim21 |
Synonyms | TRIM21; tripartite motif-containing 21; E3 ubiquitin-protein ligase TRIM21; SS-A; ro(SS-A); 52 kDa Ro protein; 52kD Ro/SSA autoantigen; Sjogren syndrome antigen A1; tripartite motif protein 21; sjoegren syndrome type A antigen; tripartite motif-containing protein 21; 52 kDa ribonucleoprotein autoantigen Ro/SS-A; Ro52; Ssa1; |
Gene ID | 20821 |
mRNA Refseq | NM_001082552 |
Protein Refseq | NP_001076021 |
◆ Recombinant Proteins | ||
TRIM21-4954R | Recombinant Rhesus monkey TRIM21 Protein, His-tagged | +Inquiry |
TRIM21-564H | Recombinant Full Length Human TRIM21 protein, N-His-tagged | +Inquiry |
Trim21-4539M | Recombinant Mouse Trim21 protein, His-SUMO-tagged | +Inquiry |
TRIM21-0259H | Recombinant Human TRIM21 Protein, Tag Free | +Inquiry |
TRIM21-671H | Recombinant Human TRIM21 Protein (Met1-Tyr475), His-tagged | +Inquiry |
◆ Native Proteins | ||
TRIM21-212B | Native Cow TRIM21 | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRIM21-791HCL | Recombinant Human TRIM21 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Trim21 Products
Required fields are marked with *
My Review for All Trim21 Products
Required fields are marked with *
0
Inquiry Basket