Recombinant Mouse Trim21 protein, His-tagged
| Cat.No. : | Trim21-7432M |
| Product Overview : | Recombinant Mouse Trim21 protein(Q62191)(1-470aa), fused with N-terminal His tag, was expressed in Insect cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | Insect cells |
| Tag : | His |
| Protein Length : | 1-470aa |
| Tag : | N-His |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 56.7 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | MSPSTTSKMSLEKMWEEVTCSICLDPMVEPMSIECGHCFCKECIFEVGKNGGSSCPECRQQFLLRNLRPNRHIANMVENLKQIAQNTKKSTQETHCMKHGEKLHLFCEEDGQALCWVCAQSGKHRDHTRVPIEEAAKVYQEKIHVVLEKLRKGKELAEKMEMDLTMQRTDWKRNIDTQKSRIHAEFALQNSLLAQEEQRQLQRLEKDQREYLRLLGKKEAELAEKNQALQELISELERRIRGSELELLQEVRIILERSGSWNLDTLDIDAPDLTSTCPVPGRKKMLRTCWVHITLDRNTANSWLIISKDRRQVRMGDTHQNVSDNKERFSNYPMVLGAQRFSSGKMYWEVDVTQKEAWDLGVCRDSVQRKGQFSLSPENGFWTIWLWQDSYEAGTSPQTTLHIQVPPCQIGIFVDYEAGVVSFYNITDHGSLIYTFSECVFAGPLRPFFNVGFNYSGGNAAPLKLCPLKM |
| Gene Name | Trim21 tripartite motif-containing 21 [ Mus musculus ] |
| Official Symbol | Trim21 |
| Synonyms | TRIM21; tripartite motif-containing 21; E3 ubiquitin-protein ligase TRIM21; SS-A; ro(SS-A); 52 kDa Ro protein; 52kD Ro/SSA autoantigen; Sjogren syndrome antigen A1; tripartite motif protein 21; sjoegren syndrome type A antigen; tripartite motif-containing protein 21; 52 kDa ribonucleoprotein autoantigen Ro/SS-A; Ro52; Ssa1; |
| Gene ID | 20821 |
| mRNA Refseq | NM_001082552 |
| Protein Refseq | NP_001076021 |
| ◆ Recombinant Proteins | ||
| TRIM21-4768R | Recombinant Rhesus Macaque TRIM21 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TRIM21-196H | Recombinant Human tripartite motif-containing 21 | +Inquiry |
| TRIM21-0259H | Recombinant Human TRIM21 Protein, Tag Free | +Inquiry |
| TRIM21-4954R | Recombinant Rhesus monkey TRIM21 Protein, His-tagged | +Inquiry |
| TRIM21-671H | Recombinant Human TRIM21 Protein (Met1-Tyr475), His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| TRIM21-212B | Native Cow TRIM21 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TRIM21-791HCL | Recombinant Human TRIM21 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Trim21 Products
Required fields are marked with *
My Review for All Trim21 Products
Required fields are marked with *
