Recombinant Mouse TSHB and TSHA Protein, His tagged

Cat.No. : TSHB-TSHA-06M
Product Overview : Recombinant Mouse TSHB and TSHA Protein, (Met1-Val138, one mutant and Ala25-Ser116) with His tag was expressed in CHO.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : CHO
Tag : His
Protein Length : TSHB: Met1-Val138, one mutant
TSHA: Ala25-Ser116
Description : Thyroid-stimulating hormone, commonly called TSH and also referred to as thyrotropin, is a hormone that your pituitary gland releases to trigger your thyroid to produce and release its own hormones-thyroxine (T4) and triiodothyronine (T3). These two hormones are essential for maintaining your body's metabolic rate-the speed at which your body transforms the food you eat into energy and uses it.
Molecular Mass : ~ 27 kDa
AA Sequence : MSMLFGLTCGQAMSFCIPTEYTMHIERRECAYCLTINTTICAGYCMTRDINGKLFLPKYALSQDVCTYRDFIYRTVEIPGCPLHVAPYFSYPVALSCKCGKCNTDYSDCIHEAIKTNYCTKPQKSYLVGFSVHHHHHH
MAPDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKSHHHHHH
Endotoxin : < 1 EU/μg protein by LAL
Purity : > 90% as determined by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.84 mg/mL
Storage Buffer : Supplied in PBS buffer, pH 7.4
Official Symbol TSHB, TSHA
Synonyms TSHB; thyroid stimulating hormone subunit beta; TSH-B; TSH-BETA; thyrotropin subunit beta; thyroid stimulating hormone beta; thyrotropin beta chain; CGA; glycoprotein hormones, alpha polypeptide; HCG; LHA; FSHA; GPA1; GPHa; TSHA; GPHA1; CG-ALPHA; glycoprotein hormones alpha chain; FSH-alpha; LSH-alpha; TSH-alpha; anterior pituitary glycoprotein hormones common subunit alpha; choriogonadotropin alpha chain; chorionic gonadotrophin subunit alpha; chorionic gonadotropin, alpha polypeptide; follicle-stimulating hormone alpha chain; follicle-stimulating hormone alpha subunit; follitropin alpha chain; luteinizing hormone alpha chain; lutropin alpha chain; thyroid-stimulating hormone alpha chain; thyrotropin alpha chain

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TSHB, TSHA Products

Required fields are marked with *

My Review for All TSHB, TSHA Products

Required fields are marked with *

0
cart-icon