Recombinant Mouse Tshb protein, hFc-tagged
| Cat.No. : | Tshb-4541M |
| Product Overview : | Recombinant Mouse Tshb protein(P12656)(56-132 aa), fused with C-terminal hFc tag, was expressed in Mammalian Cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | Mammalian Cells |
| Tag : | Fc |
| Protein Length : | 56-132 aa |
| Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
| Molecular Mass : | 39.0 kDa |
| AASequence : | INGKLFLPKYALSQDVCTYRDFIYRTVEIPGCPHHVTPYFSFPVAVSCKCGKCNTDNSDCIHEAVRTNYCTKPQSFY |
| Purity : | Greater than 95% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
| Gene Name | Tshb thyroid stimulating hormone, beta subunit [ Mus musculus ] |
| Official Symbol | Tshb |
| Synonyms | TSHB; thyroid stimulating hormone, beta subunit; thyrotropin subunit beta; TSH-B; TSH-beta; thyrotropin beta chain; thyroid-stimulating hormone subunit beta; MGC151206; MGC151208; |
| Gene ID | 22094 |
| mRNA Refseq | NM_001165939 |
| Protein Refseq | NP_001159411 |
| ◆ Recombinant Proteins | ||
| TSHB-2417R | Recombinant Rat TSHB Protein (21-132 aa), His-Myc-tagged | +Inquiry |
| TSHB-6316R | Recombinant Rat TSHB Protein | +Inquiry |
| Tshb-7935M | Recombinant Mouse Tshb protein, His-tagged | +Inquiry |
| Tshb-4541M | Recombinant Mouse Tshb protein, hFc-tagged | +Inquiry |
| TSHB-3625D | Recombinant Dog TSHB protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| TSHB-704H | Native Human Thyroid Stimulating Hormone, Beta | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tshb Products
Required fields are marked with *
My Review for All Tshb Products
Required fields are marked with *



