Recombinant Mouse Tshb protein, hFc-tagged
Cat.No. : | Tshb-4541M |
Product Overview : | Recombinant Mouse Tshb protein(P12656)(56-132 aa), fused with C-terminal hFc tag, was expressed in Mammalian Cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Mammalian Cells |
Tag : | Fc |
Protein Length : | 56-132 aa |
Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
Molecular Mass : | 39.0 kDa |
AASequence : | INGKLFLPKYALSQDVCTYRDFIYRTVEIPGCPHHVTPYFSFPVAVSCKCGKCNTDNSDCIHEAVRTNYCTKPQSFY |
Purity : | Greater than 95% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
Gene Name | Tshb thyroid stimulating hormone, beta subunit [ Mus musculus ] |
Official Symbol | Tshb |
Synonyms | TSHB; thyroid stimulating hormone, beta subunit; thyrotropin subunit beta; TSH-B; TSH-beta; thyrotropin beta chain; thyroid-stimulating hormone subunit beta; MGC151206; MGC151208; |
Gene ID | 22094 |
mRNA Refseq | NM_001165939 |
Protein Refseq | NP_001159411 |
◆ Recombinant Proteins | ||
TSHB-3626H | Recombinant Human TSHB protein, His-SUMO-tagged | +Inquiry |
TSHB-5973R | Recombinant Rat TSHB Protein, His (Fc)-Avi-tagged | +Inquiry |
TSHB-6316R | Recombinant Rat TSHB Protein | +Inquiry |
Tshb-6684M | Recombinant Mouse Tshb Protein, Myc/DDK-tagged | +Inquiry |
TSHB-51H | Recombinant Human Thyroid Stimulating Hormone Beta | +Inquiry |
◆ Native Proteins | ||
TSHB-704H | Native Human Thyroid Stimulating Hormone, Beta | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tshb Products
Required fields are marked with *
My Review for All Tshb Products
Required fields are marked with *
0
Inquiry Basket