Recombinant Mouse Tshb protein, hFc-tagged

• Cat.No.: Tshb-4541M
• Product Overview: Recombinant Mouse Tshb protein(P12656)(56-132 aa), fused with C-terminal hFc tag, was expressed in Mammalian Cells.

Specification

• Species: Mouse
• Source: Mammalian Cells
• Tag: Fc
• Protein Length: 56-132 aa
• Form: For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
• Molecular Mass: 39.0 kDa
• AASequence: INGKLFLPKYALSQDVCTYRDFIYRTVEIPGCPHHVTPYFSFPVAVSCKCGKCNTDNSDCIHEAVRTNYCTKPQSFY
• Purity: Greater than 95% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.

Gene Information

• Gene Name: Tshb thyroid stimulating hormone, beta subunit [ Mus musculus ]
• Official Symbol: Tshb
• Synonyms: TSHB; thyroid stimulating hormone, beta subunit; thyrotropin subunit beta; TSH-B; TSH-beta; thyrotropin beta chain; thyroid-stimulating hormone subunit beta; MGC151206; MGC151208
• Gene ID: 22094
• mRNA Refseq: NM_001165939
• Protein Refseq: NP_001159411