Recombinant Mouse Tshb protein, hFc-tagged

Cat.No. : Tshb-4541M
Product Overview : Recombinant Mouse Tshb protein(P12656)(56-132 aa), fused with C-terminal hFc tag, was expressed in Mammalian Cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : Mammalian Cells
Tag : Fc
Protein Length : 56-132 aa
Form : For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
Molecular Mass : 39.0 kDa
AASequence : INGKLFLPKYALSQDVCTYRDFIYRTVEIPGCPHHVTPYFSFPVAVSCKCGKCNTDNSDCIHEAVRTNYCTKPQSFY
Purity : Greater than 95% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.
Gene Name Tshb thyroid stimulating hormone, beta subunit [ Mus musculus ]
Official Symbol Tshb
Synonyms TSHB; thyroid stimulating hormone, beta subunit; thyrotropin subunit beta; TSH-B; TSH-beta; thyrotropin beta chain; thyroid-stimulating hormone subunit beta; MGC151206; MGC151208;
Gene ID 22094
mRNA Refseq NM_001165939
Protein Refseq NP_001159411

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Tshb Products

Required fields are marked with *

My Review for All Tshb Products

Required fields are marked with *

0

Inquiry Basket

cartIcon