"Ttr" Related Products

Recombinant Mouse Ttr Protein

Cat.No.: Ttr-1392M
Product Overview: Recombinant Mouse Ttr Protein (23-147aa) was expressed in E. coli with N-terminal His tag.
Source: E. coli
Species: Mouse
Form: Tris-based buffer, 50% glycerol.
Molecular Mass: 13.5 kDa
AA Sequence: AGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVE
LDTKSYWKTLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name: Ttr transthyretin [ Mus musculus (house mouse) ]
Official Symbol: Ttr
Synonyms: D17860; AA408768; AI787086; prealbumin
Gene ID: 22139
mRNA Refseq: NM_013697.5
Protein Refseq: NP_038725.1
UniProt ID: P07309

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.