Recombinant Mouse Ttr Protein

PRODUCTS

Home / Products / Recombinant Mouse Ttr Protein

Recombinant Mouse Ttr Protein

Ttr Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : Ttr-1392M
Product Overview : Recombinant Mouse Ttr Protein (23-147aa) was expressed in E. coli with N-terminal His tag.
Source : E. coli
Species : Mouse
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 13.5 kDa
AA Sequence : AGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVE
LDTKSYWKTLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name : Ttr transthyretin [ Mus musculus (house mouse) ]
Official Symbol : Ttr
Synonyms : D17860; AA408768; AI787086; prealbumin
Gene ID : 22139
mRNA Refseq : NM_013697.5
Protein Refseq : NP_038725.1
UniProt ID : P07309

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved.