Recombinant Mouse Ttr Protein
| Cat.No. : | Ttr-1392M |
| Product Overview : | Recombinant Mouse Ttr Protein (23-147aa) was expressed in E. coli with N-terminal His tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 23-147 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 13.5 kDa |
| AA Sequence : | AGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVE LDTKSYWKTLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | Ttr transthyretin [ Mus musculus (house mouse) ] |
| Official Symbol | Ttr |
| Synonyms | D17860; AA408768; AI787086; prealbumin |
| Gene ID | 22139 |
| mRNA Refseq | NM_013697.5 |
| Protein Refseq | NP_038725.1 |
| UniProt ID | P07309 |
| ◆ Recombinant Proteins | ||
| TTR-728H | Recombinant Human TTR protein, His-tagged | +Inquiry |
| TTR-6215H | Recombinant Human TTR Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| TTR-128H | Recombinant Human TTR Protein, His-tagged | +Inquiry |
| TTR-730P | Recombinant Pig TTR protein, His & T7-tagged | +Inquiry |
| TTR-1438Z | Recombinant Zebrafish TTR | +Inquiry |
| ◆ Native Proteins | ||
| TTR-31108TH | Native Human TTR | +Inquiry |
| TTR-155B | Native Bovine Prealbumin protein | +Inquiry |
| TTR-141S | Native Sheep prealbumin | +Inquiry |
| TTR-254H | Native Human Prealbumin | +Inquiry |
| TTR-706H | Native Human Transthyretin | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TTR-2149HCL | Recombinant Human TTR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ttr Products
Required fields are marked with *
My Review for All Ttr Products
Required fields are marked with *
