Recombinant Mouse Ttr Protein
Cat.No. : | Ttr-1392M |
Product Overview : | Recombinant Mouse Ttr Protein (23-147aa) was expressed in E. coli with N-terminal His tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | Non |
Protein Length : | 23-147 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 13.5 kDa |
AA Sequence : | AGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVE LDTKSYWKTLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | Ttr transthyretin [ Mus musculus (house mouse) ] |
Official Symbol | Ttr |
Synonyms | D17860; AA408768; AI787086; prealbumin |
Gene ID | 22139 |
mRNA Refseq | NM_013697.5 |
Protein Refseq | NP_038725.1 |
UniProt ID | P07309 |
◆ Recombinant Proteins | ||
TTR-724C | Recombinant Cattle TTR protein, His-tagged | +Inquiry |
Ttr-5542M | Recombinant Mouse Ttr protein, His-tagged | +Inquiry |
Ttr-729M | Recombinant Mouse Ttr protein, His-tagged | +Inquiry |
TTR-31110TH | Recombinant Human TTR | +Inquiry |
TTR-01H | Recombinant Cynomolgus TTR Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
TTR-131H | Native Human Prealbumin protein | +Inquiry |
TTR-706H | Native Human Transthyretin | +Inquiry |
TTR-254H | Native Human Prealbumin | +Inquiry |
TTR-155B | Native Bovine Prealbumin protein | +Inquiry |
TTR-31108TH | Native Human TTR | +Inquiry |
◆ Cell & Tissue Lysates | ||
TTR-2149HCL | Recombinant Human TTR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ttr Products
Required fields are marked with *
My Review for All Ttr Products
Required fields are marked with *