Recombinant Mouse Tuba1a protein
Cat.No. : | Tuba1a-5379M |
Product Overview : | Recombinant Mouse Tuba1a protein(P68369)(1-451 aa) was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Mammalian cells |
Tag : | Non |
Protein Length : | 1-451 aa |
Form : | Tris/PBS-based buffer, 6% Trehalose. |
AASequence : | MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLD RIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTA VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITA SLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN QMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPP TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE AREDMAALEKDYEEVGVDSVEGEGEEEGEEY |
Purity : | >85% (SDS-PAGE) |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | Tuba1a tubulin, alpha 1A [ Mus musculus ] |
Official Symbol | Tuba1a |
Synonyms | TUBA1A; tubulin, alpha 1A; tubulin alpha-1A chain; alpha-tubulin 1; tubulin, alpha 1; Talpha1 alpha-tubulin; tubulin alpha-1 chain; alpha-tubulin isotype M-alpha-1; Tuba1; Tuba-1; MGC102097; MGC102098; MGC102099; |
Gene ID | 22142 |
mRNA Refseq | NM_011653 |
Protein Refseq | NP_035783 |
◆ Recombinant Proteins | ||
Tuba1a-5376M | Recombinant Mouse Tuba1a protein | +Inquiry |
TUBA1A-3184H | Recombinant Human TUBA1A protein, His-tagged | +Inquiry |
TUBA1A-6354R | Recombinant Rat TUBA1A Protein | +Inquiry |
TUBA1A-533HF | Recombinant Full Length Human TUBA1A Protein, GST-tagged | +Inquiry |
Tuba1a-5378M | Recombinant Mouse Tuba1a protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TUBA1A-662HCL | Recombinant Human TUBA1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tuba1a Products
Required fields are marked with *
My Review for All Tuba1a Products
Required fields are marked with *