Recombinant Mouse Tuba1c protein, Avi-tagged, Biotinylated
| Cat.No. : | Tuba1c-5054M |
| Product Overview : | Biotinylated Recombinant Mouse Tuba1c protein(P68373)(1-449 aa), fused with Avi tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | Avi |
| Protein Length : | 1-449 aa |
| Conjugation/Label : | Biotin |
| Form : | Tris/PBS-based buffer, 6% Trehalose. |
| AASequence : | MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLD RIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTA VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITA SLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNACFEPAN QMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPP TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE AREDMAALEKDYEEVGADSAEGDDEGEEY |
| Purity : | >85% (SDS-PAGE) |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
| Conjugation : | Biotin |
| Gene Name | Tuba1c tubulin, alpha 1C [ Mus musculus ] |
| Official Symbol | Tuba1c |
| Synonyms | TUBA1C; tubulin, alpha 1C; tubulin alpha-1C chain; alpha-tubulin 6; tubulin, alpha 6; tubulin alpha-6 chain; alpha-tubulin isotype M-alpha-6; M[a]6; Tuba6; |
| Gene ID | 22146 |
| mRNA Refseq | NM_009448 |
| Protein Refseq | NP_033474 |
| ◆ Recombinant Proteins | ||
| Tuba1c-5055M | Recombinant Mouse Tuba1c protein | +Inquiry |
| Tuba1c-5054M | Recombinant Mouse Tuba1c protein, Avi-tagged, Biotinylated | +Inquiry |
| TUBA1C-2004H | Recombinant Human TUBA1C Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| TUBA1C-6012R | Recombinant Rat TUBA1C Protein, His (Fc)-Avi-tagged | +Inquiry |
| Tuba1c-5056M | Recombinant Mouse Tuba1c protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TUBA1C-660HCL | Recombinant Human TUBA1C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tuba1c Products
Required fields are marked with *
My Review for All Tuba1c Products
Required fields are marked with *
