Recombinant Mouse tumor necrosis factor receptor superfamily, member 11a, NFKB activator Protein, His&Fc tagged

Cat.No. : Tnfrsf11a-08M
Product Overview : Recombinant mouse RANK (31-214aa), fused to hlgG-His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : Baculovirus
Tag : Fc&His
Protein Length : 31-214aa
Description : Enables tumor necrosis factor-activated receptor activity. Involved in several processes, including circadian temperature homeostasis; positive regulation of fever generation by positive regulation of prostaglandin secretion; and tumor necrosis factor-mediated signaling pathway. Acts upstream of or within several processes, including hematopoietic or lymphoid organ development; mammary gland alveolus development; and positive regulation of bone resorption. Located in cell surface. Is expressed in bladder and lymphatic system. Human ortholog(s) of this gene implicated in Paget''s disease of bone; autosomal recessive osteopetrosis 7; bone development disease; familial expansile osteolysis; and osteoporosis. Orthologous to human TNFRSF11A (TNF receptor superfamily member 11a).
Tag : C-His&Fc
Form : Liquid
Bio-activity : Measured by its binding ability in a functional ELISA with Mouse RANKL/TNFSF11. The ED50 range ≤ 200 ng/mL.
Molecular Mass : 47.5 kDa
AA Sequence : VTPPCTQERHYEHLGRCCSRCEPGKYLSSKCTPTSDSVCLPCGPDEYLDTWNEEDKCLLHKVCDAGKALVAVDPGNHTAPRRCACTAGYHWNSDCECCRRNTECAPGFGAQHPLQLNKDTVCTPCLLGFFSDVFSSTDKCKPWTNCTLLGKLEAHQGTTESDVVCSSSMTLRRPPKEAQAYLPS
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 90% by SDS-PAGE
Applications : SDS-PAGE, Bioactivity
Notes : For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Concentration : 1 mg/mL (determined by absorbance at 280nm)
References : 1. Anderson, D.M. et al. (1997) Nature 390, 175-179.
2. Nakagawa, N. et al. (1998) Biochem. Biophys. Res. Commun. 245:395-400.
3. Bharat B. Aggarwal. (2003) Nature 3, 745-756.
Gene Name Tnfrsf11a tumor necrosis factor receptor superfamily, member 11a, NFKB activator [ Mus musculus (house mouse) ]
Official Symbol Tnfrsf11a
Synonyms Tnfrsf11a; tumor necrosis factor receptor superfamily, member 11a, NFKB activator; OFE; ODFR; Rank; Ly109; mRANK; TRANCE-R; tumor necrosis factor receptor superfamily member 11A; osteoclast differentiation factor receptor; receptor activator of NF-KB; receptor activator of NF-kappaB
Gene ID 21934
mRNA Refseq NM_009399
Protein Refseq NP_033425
UniProt ID O35305

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Tnfrsf11a Products

Required fields are marked with *

My Review for All Tnfrsf11a Products

Required fields are marked with *

0
cart-icon