Recombinant Mouse tumor necrosis factor receptor superfamily, member 11a, NFKB activator Protein, His&Fc tagged

• Cat.No.: Tnfrsf11a-08M
• Product Overview: Recombinant mouse RANK (31-214aa), fused to hlgG-His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.

Specification

• Species: Mouse
• Source: Baculovirus
• Tag: Fc&His
• Protein Length: 31-214aa
• Description: Enables tumor necrosis factor-activated receptor activity. Involved in several processes, including circadian temperature homeostasis; positive regulation of fever generation by positive regulation of prostaglandin secretion; and tumor necrosis factor-mediated signaling pathway. Acts upstream of or within several processes, including hematopoietic or lymphoid organ development; mammary gland alveolus development; and positive regulation of bone resorption. Located in cell surface. Is expressed in bladder and lymphatic system. Human ortholog(s) of this gene implicated in Paget''s disease of bone; autosomal recessive osteopetrosis 7; bone development disease; familial expansile osteolysis; and osteoporosis. Orthologous to human TNFRSF11A (TNF receptor superfamily member 11a).
• Tag: C-His&Fc
• Form: Liquid
• Bio-activity: Measured by its binding ability in a functional ELISA with Mouse RANKL/TNFSF11. The ED50 range ≤ 200 ng/mL.
• Molecular Mass: 47.5 kDa
• AA Sequence: VTPPCTQERHYEHLGRCCSRCEPGKYLSSKCTPTSDSVCLPCGPDEYLDTWNEEDKCLLHKVCDAGKALVAVDPGNHTAPRRCACTAGYHWNSDCECCRRNTECAPGFGAQHPLQLNKDTVCTPCLLGFFSDVFSSTDKCKPWTNCTLLGKLEAHQGTTESDVVCSSSMTLRRPPKEAQAYLPS
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 90% by SDS-PAGE
• Applications: SDS-PAGE, Bioactivity
• Notes: For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Storage Buffer: Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
• Concentration: 1 mg/mL (determined by absorbance at 280nm)
• References: 1. Anderson, D.M. et al. (1997) Nature 390, 175-179.
  2. Nakagawa, N. et al. (1998) Biochem. Biophys. Res. Commun. 245:395-400.
  3. Bharat B. Aggarwal. (2003) Nature 3, 745-756.

Gene Information

• Gene Name: Tnfrsf11a tumor necrosis factor receptor superfamily, member 11a, NFKB activator [ Mus musculus (house mouse) ]
• Official Symbol: Tnfrsf11a
• Synonyms: Tnfrsf11a; tumor necrosis factor receptor superfamily, member 11a, NFKB activator; OFE; ODFR; Rank; Ly109; mRANK; TRANCE-R; tumor necrosis factor receptor superfamily member 11A; osteoclast differentiation factor receptor; receptor activator of NF-KB; receptor activator of NF-kappaB
• Gene ID: 21934
• mRNA Refseq: NM_009399
• Protein Refseq: NP_033425
• UniProt ID: O35305