Recombinant Mouse tumor necrosis factor receptor superfamily member 14 protein, His&Fc tagged
Cat.No. : | Tnfrsf14-01M |
Product Overview : | Recombinant mouse HVEM/TNFRSF14 (39-206 aa), fused to hIgG-His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Baculovirus |
Tag : | Fc&His |
Protein Length : | 39-206 aa |
Description : | Predicted to enable cytokine binding activity and ubiquitin protein ligase binding activity. Acts upstream of or within several processes, including defense response to bacterium; negative regulation of alpha-beta T cell proliferation; and positive regulation of macromolecule metabolic process. Located in external side of plasma membrane. Is expressed in liver lobe. Orthologous to human TNFRSF14 (TNF receptor superfamily member 14). |
Tag : | C-hIgG-His |
Form : | Liquid |
Molecular Mass : | 45.3 kDa (407aa) |
AA Sequence : | QPSCRQEEFLVGDECCPMCNPGYHVKQVCSEHTGTVCAPCPPQTYTAHANGLSKCLPCGVCDPDMGLLTWQECSSWKDTVCRCIPGYFCENQDGSHCSTCLQHTTCPPGQRVEKRGTHDQDTVCADCLTGTFSLGGTQEECLPWTNCSAFQQEVRRGTNSTDTTCSSQ< LEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH> |
Endotoxin : | < 1.0 EU/μg of the protein by the LAL method. |
Purity : | > 90% by SDS-PAGE |
Applications : | SDS-PAGE |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 0.25 mg/mL (determined by absorbance at 280nm) |
Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
References : | 1. Choi EK., et al. (2013) J Endocrinol. 220:25-33. 2. Kotsiou E., et al. (2018) Blood. 128:72-81. |
Gene Name | Tnfrsf14 tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator) [ Mus musculus (house mouse) ] |
Official Symbol | Tnfrsf14 |
Synonyms | Tnfrsf14; tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator); TR2; Atar; HveA; Hvem; Tnfrs14; tumor necrosis factor receptor superfamily member 14; herpes virus entry mediator A; herpesvirus entry mediator A; tumor necrosis factor receptor-like 2 |
Gene ID | 230979 |
mRNA Refseq | NM_178931 |
Protein Refseq | NP_849262 |
UniProt ID | Q80WM9 |
◆ Recombinant Proteins | ||
TNFRSF14-555HAF647 | Recombinant Human TNFRSF14 Protein, His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
TNFRSF14-877H | Recombinant Human TNFRSF14 Protein, DDK/His-tagged | +Inquiry |
TNFRSF14-1538H | Recombinant Human TNFRSF14 protein, hFc-tagged | +Inquiry |
TNFRSF14-1991H | Recombinant Human TNFRSF14 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TNFRSF14-671H | Recombinant Human TNFRSF14 Protein, Strep-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF14-2155HCL | Recombinant Human TNFRSF14 cell lysate | +Inquiry |
TNFRSF14-2420MCL | Recombinant Mouse TNFRSF14 cell lysate | +Inquiry |
TNFRSF14-1133CCL | Recombinant Cynomolgus TNFRSF14 cell lysate | +Inquiry |
TNFRSF14-001MCL | Recombinant Mouse TNFRSF14 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tnfrsf14 Products
Required fields are marked with *
My Review for All Tnfrsf14 Products
Required fields are marked with *