Recombinant Mouse tumor necrosis factor receptor superfamily member 14 protein, His&Fc tagged

Cat.No. : Tnfrsf14-01M
Product Overview : Recombinant mouse HVEM/TNFRSF14 (39-206 aa), fused to hIgG-His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : Baculovirus
Tag : Fc&His
Protein Length : 39-206 aa
Description : Predicted to enable cytokine binding activity and ubiquitin protein ligase binding activity. Acts upstream of or within several processes, including defense response to bacterium; negative regulation of alpha-beta T cell proliferation; and positive regulation of macromolecule metabolic process. Located in external side of plasma membrane. Is expressed in liver lobe. Orthologous to human TNFRSF14 (TNF receptor superfamily member 14).
Tag : C-hIgG-His
Form : Liquid
Molecular Mass : 45.3 kDa (407aa)
AA Sequence : QPSCRQEEFLVGDECCPMCNPGYHVKQVCSEHTGTVCAPCPPQTYTAHANGLSKCLPCGVCDPDMGLLTWQECSSWKDTVCRCIPGYFCENQDGSHCSTCLQHTTCPPGQRVEKRGTHDQDTVCADCLTGTFSLGGTQEECLPWTNCSAFQQEVRRGTNSTDTTCSSQ< LEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH>
Endotoxin : < 1.0 EU/μg of the protein by the LAL method.
Purity : > 90% by SDS-PAGE
Applications : SDS-PAGE
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.25 mg/mL (determined by absorbance at 280nm)
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
References : 1. Choi EK., et al. (2013) J Endocrinol. 220:25-33.
2. Kotsiou E., et al. (2018) Blood. 128:72-81.
Gene Name Tnfrsf14 tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator) [ Mus musculus (house mouse) ]
Official Symbol Tnfrsf14
Synonyms Tnfrsf14; tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator); TR2; Atar; HveA; Hvem; Tnfrs14; tumor necrosis factor receptor superfamily member 14; herpes virus entry mediator A; herpesvirus entry mediator A; tumor necrosis factor receptor-like 2
Gene ID 230979
mRNA Refseq NM_178931
Protein Refseq NP_849262
UniProt ID Q80WM9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Tnfrsf14 Products

Required fields are marked with *

My Review for All Tnfrsf14 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon