Recombinant Mouse TXNDC12 Protein (25-170 aa), His-tagged

• Cat.No.: TXNDC12-1925M
• Product Overview: Recombinant Mouse TXNDC12 Protein (25-170 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length of Mature Protein.

Specification

• Species: Mouse
• Source: Yeast
• Tag: His
• Protein Length: 25-170 aa
• Description: Possesses significant protein thiol-disulfide oxidase activity.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 18.5 kDa
• AA Sequence: RTGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPRDEDFSPDGGYIPRILFLDPSGKVRPEIINESGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFREKHFQDEL
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: Txndc12 thioredoxin domain containing 12 (endoplasmic reticulum) [ Mus musculus ]
• Official Symbol: TXNDC12
• Synonyms: TXNDC12; ER protein 19; ERp16; ERp19; 0610040B21Rik
• Gene ID: 66073
• mRNA Refseq: NM_025334
• Protein Refseq: NP_079610
• UniProt ID: Q9CQU0