Recombinant Mouse Tyk2 protein(884-1174aa), His&Myc-tagged
| Cat.No. : | Tyk2-7543M |
| Product Overview : | Recombinant Mouse Tyk2 protein(Q9R117)(884-1174aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 884-1174aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 41.2 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | SDPTVFHKRYLKKIRDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKEGCGPQLRSGWQREIEILRTLYHEHIVKYKGCCEDQGEKSVQLVMEYVPLGSLRDYLPRHCVGLAQLLLFAQQICEGMAYLHAQHYIHRDLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKECKFYYASDVWSFGVTLYELLTYCDSNQSPHMKFTELIGHTQGQMTVLRLTELLERGERLPRPDRCPCEIYHLMKNCWETEASFRPTFQNLVPILQTAQEKYQ |
| Gene Name | Tyk2 tyrosine kinase 2 [ Mus musculus ] |
| Official Symbol | Tyk2 |
| Synonyms | TYK2; tyrosine kinase 2; non-receptor tyrosine-protein kinase TYK2; tyrosine kinase TYK2; JTK1; |
| Gene ID | 54721 |
| mRNA Refseq | NM_001205312 |
| Protein Refseq | NP_001192241 |
| ◆ Recombinant Proteins | ||
| TYK2-31641TH | Recombinant Human TYK2 | +Inquiry |
| TYK2-1505H | Active Recombinant Human TYK2, GST-tagged | +Inquiry |
| TYK2-2284H | Recombinant Human TYK2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TYK2-01H | Recombinant Human TYK2 (JH2 domain, 575-869), N-FLAG-tagged | +Inquiry |
| TYK2-2115H | Recombinant Human TYK2 protein(556-871aa), His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TYK2-1867HCL | Recombinant Human TYK2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tyk2 Products
Required fields are marked with *
My Review for All Tyk2 Products
Required fields are marked with *
