Recombinant Mouse UPK2 Protein (85-184 aa), His-GST-tagged

• Cat.No.: UPK2-2408M
• Product Overview: Recombinant Mouse UPK2 Protein (85-184 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-GST tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length of Mature Protein.

Specification

• Species: Mouse
• Source: E.coli
• Tag: GST&His
• Protein Length: 85-184 aa
• Description: Component of the asymmetric unit membrane (AUM); a highly specialized biomembrane elaborated by terminally differentiated urothelial cells. May play an important role in regulating the assembly of the AUM.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 40.8 kDa
• AA Sequence: ELVSVVDSGSGYTVTRLSAYQVTNLTPGTKYYISYRVQKGTSTESSPETPMSTLPRKNMESIGLGMARTGGMVVITVLLSVAMFLLVVGLIVALHWDARK
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: Upk2 uroplakin 2 [ Mus musculus (house mouse) ]
• Official Symbol: UPK2
• Synonyms: Upk2; UPII; AW491716
• Gene ID: 22269
• UniProt ID: P38575