Recombinant Mouse UPK2 Protein (85-184 aa), His-GST-tagged
Cat.No. : | UPK2-2408M |
Product Overview : | Recombinant Mouse UPK2 Protein (85-184 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-GST tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | GST&His |
Protein Length : | 85-184 aa |
Description : | Component of the asymmetric unit membrane (AUM); a highly specialized biomembrane elaborated by terminally differentiated urothelial cells. May play an important role in regulating the assembly of the AUM. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 40.8 kDa |
AA Sequence : | ELVSVVDSGSGYTVTRLSAYQVTNLTPGTKYYISYRVQKGTSTESSPETPMSTLPRKNMESIGLGMARTGGMVVITVLLSVAMFLLVVGLIVALHWDARK |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | Upk2 uroplakin 2 [ Mus musculus (house mouse) ] |
Official Symbol | UPK2 |
Synonyms | Upk2; UPII; AW491716; |
Gene ID | 22269 |
UniProt ID | P38575 |
◆ Recombinant Proteins | ||
UPK2-630H | Recombinant Human UPK2 Protein, MYC/DDK-tagged | +Inquiry |
RFL13965HF | Recombinant Full Length Human Uroplakin-2(Upk2) Protein, His-Tagged | +Inquiry |
Upk2-6832M | Recombinant Mouse Upk2 Protein (Asp26-Gly115), N-His tagged | +Inquiry |
UPK2-0193H | Recombinant Human UPK2 Full Length Transmembrane protein, His-SUMO-tagged | +Inquiry |
Upk2-6847M | Recombinant Mouse Upk2 Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UPK2 Products
Required fields are marked with *
My Review for All UPK2 Products
Required fields are marked with *
0
Inquiry Basket