Recombinant Mouse UPK2 Protein (85-184 aa), His-GST-tagged

Cat.No. : UPK2-2408M
Product Overview : Recombinant Mouse UPK2 Protein (85-184 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-GST tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : GST&His
Protein Length : 85-184 aa
Description : Component of the asymmetric unit membrane (AUM); a highly specialized biomembrane elaborated by terminally differentiated urothelial cells. May play an important role in regulating the assembly of the AUM.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 40.8 kDa
AA Sequence : ELVSVVDSGSGYTVTRLSAYQVTNLTPGTKYYISYRVQKGTSTESSPETPMSTLPRKNMESIGLGMARTGGMVVITVLLSVAMFLLVVGLIVALHWDARK
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name Upk2 uroplakin 2 [ Mus musculus (house mouse) ]
Official Symbol UPK2
Synonyms Upk2; UPII; AW491716;
Gene ID 22269
UniProt ID P38575

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UPK2 Products

Required fields are marked with *

My Review for All UPK2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon