| Cat.No. : | UPK3A-2498M |
| Product Overview : | Recombinant Mouse UPK3A Protein (19-207 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Tags & Cell Markers. Protein Description: Partial. |
| Description : | Component of the asymmetric unit membrane (AUM); a highly specialized biomembrane elaborated by terminally differentiated urothelial cells. May play an important role in AUM-cytoskeleton interaction in terminally differentiated urothelial cells. It also contributes to the formation of urothelial glycocalyx which may play an important role in preventing bacterial adherence. |
| Source : | E. coli |
| Species : | Mouse |
| Tag : | His-Myc |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 25.5 kDa |
| Protein length : | 19-207 aa |
| AA Sequence : | VNLQPQLASVTFATNNPTLTTVALEKPLCMFDSSEPLSGSYEVYLYAMVDSAMSRNVSVQDSAGVPLSTTFRQTQGGRSGPYKAAAFDLTPCGDLPSLDAVGDVTQASEILNAYLVRVGNNGTCFWDPNFQGLCNPPLTAATEYRFKYVLVNMSTGLVQDQTLWSDPIWTNRPIPYSAIDTWPGRRSGG |
| Purity : | > 85% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name : | Upk3a uroplakin 3A [ Mus musculus ] |
| Official Symbol : | UPK3A |
| Synonyms : | UPK3A; uroplakin 3A; uroplakin-3a; uroplakin 3; uroplakin III; proplakin IIIa; UP3a; Upk3; UPIII; 1110017C07Rik; MGC159039; MGC159041; |
| Gene ID : | 22270 |
| mRNA Refseq : | NM_023478 |
| Protein Refseq : | NP_075967 |
| UniProt ID : | Q9JKX8 |
Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.
Download Datasheet
See All UPK3A Products
Download Datasheet