Recombinant Mouse UPK3A Protein (19-207 aa), His-Myc-tagged

Cat.No. : UPK3A-2498M
Product Overview : Recombinant Mouse UPK3A Protein (19-207 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Tags & Cell Markers. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His&Myc
Protein Length : 19-207 aa
Description : Component of the asymmetric unit membrane (AUM); a highly specialized biomembrane elaborated by terminally differentiated urothelial cells. May play an important role in AUM-cytoskeleton interaction in terminally differentiated urothelial cells. It also contributes to the formation of urothelial glycocalyx which may play an important role in preventing bacterial adherence.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 25.5 kDa
AA Sequence : VNLQPQLASVTFATNNPTLTTVALEKPLCMFDSSEPLSGSYEVYLYAMVDSAMSRNVSVQDSAGVPLSTTFRQTQGGRSGPYKAAAFDLTPCGDLPSLDAVGDVTQASEILNAYLVRVGNNGTCFWDPNFQGLCNPPLTAATEYRFKYVLVNMSTGLVQDQTLWSDPIWTNRPIPYSAIDTWPGRRSGG
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name Upk3a uroplakin 3A [ Mus musculus ]
Official Symbol UPK3A
Synonyms UPK3A; uroplakin 3A; uroplakin-3a; uroplakin 3; uroplakin III; proplakin IIIa; UP3a; Upk3; UPIII; 1110017C07Rik; MGC159039; MGC159041;
Gene ID 22270
mRNA Refseq NM_023478
Protein Refseq NP_075967
UniProt ID Q9JKX8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UPK3A Products

Required fields are marked with *

My Review for All UPK3A Products

Required fields are marked with *

0
cart-icon