Recombinant Mouse UPK3A Protein (19-207 aa), His-Myc-tagged

• Cat.No.: UPK3A-2498M
• Product Overview: Recombinant Mouse UPK3A Protein (19-207 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Tags & Cell Markers. Protein Description: Partial.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His&Myc
• Protein Length: 19-207 aa
• Description: Component of the asymmetric unit membrane (AUM); a highly specialized biomembrane elaborated by terminally differentiated urothelial cells. May play an important role in AUM-cytoskeleton interaction in terminally differentiated urothelial cells. It also contributes to the formation of urothelial glycocalyx which may play an important role in preventing bacterial adherence.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 25.5 kDa
• AA Sequence: VNLQPQLASVTFATNNPTLTTVALEKPLCMFDSSEPLSGSYEVYLYAMVDSAMSRNVSVQDSAGVPLSTTFRQTQGGRSGPYKAAAFDLTPCGDLPSLDAVGDVTQASEILNAYLVRVGNNGTCFWDPNFQGLCNPPLTAATEYRFKYVLVNMSTGLVQDQTLWSDPIWTNRPIPYSAIDTWPGRRSGG
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: Upk3a uroplakin 3A [ Mus musculus ]
• Official Symbol: UPK3A
• Synonyms: UPK3A; uroplakin 3A; uroplakin-3a; uroplakin 3; uroplakin III; proplakin IIIa; UP3a; Upk3; UPIII; 1110017C07Rik; MGC159039; MGC159041
• Gene ID: 22270
• mRNA Refseq: NM_023478
• Protein Refseq: NP_075967
• UniProt ID: Q9JKX8