Recombinant Mouse UPK3A Protein (19-207 aa), His-Myc-tagged
| Cat.No. : | UPK3A-2498M |
| Product Overview : | Recombinant Mouse UPK3A Protein (19-207 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Tags & Cell Markers. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 19-207 aa |
| Description : | Component of the asymmetric unit membrane (AUM); a highly specialized biomembrane elaborated by terminally differentiated urothelial cells. May play an important role in AUM-cytoskeleton interaction in terminally differentiated urothelial cells. It also contributes to the formation of urothelial glycocalyx which may play an important role in preventing bacterial adherence. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 25.5 kDa |
| AA Sequence : | VNLQPQLASVTFATNNPTLTTVALEKPLCMFDSSEPLSGSYEVYLYAMVDSAMSRNVSVQDSAGVPLSTTFRQTQGGRSGPYKAAAFDLTPCGDLPSLDAVGDVTQASEILNAYLVRVGNNGTCFWDPNFQGLCNPPLTAATEYRFKYVLVNMSTGLVQDQTLWSDPIWTNRPIPYSAIDTWPGRRSGG |
| Purity : | > 85% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | Upk3a uroplakin 3A [ Mus musculus ] |
| Official Symbol | UPK3A |
| Synonyms | UPK3A; uroplakin 3A; uroplakin-3a; uroplakin 3; uroplakin III; proplakin IIIa; UP3a; Upk3; UPIII; 1110017C07Rik; MGC159039; MGC159041; |
| Gene ID | 22270 |
| mRNA Refseq | NM_023478 |
| Protein Refseq | NP_075967 |
| UniProt ID | Q9JKX8 |
| ◆ Recombinant Proteins | ||
| UPK3A-6545H | Recombinant Human UPK3A Protein (Phe15-Ile211), His tagged | +Inquiry |
| UPK3A-4747H | Recombinant Human Uroplakin 3A, His-tagged | +Inquiry |
| UPK3A-284H | Recombinant Human UPK3A Protein, His-tagged | +Inquiry |
| UPK3A-9928M | Recombinant Mouse UPK3A Protein, His (Fc)-Avi-tagged | +Inquiry |
| Upk3a-285R | Recombinant Rat Upk3a Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| UPK3A-724HCL | Recombinant Human UPK3A lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UPK3A Products
Required fields are marked with *
My Review for All UPK3A Products
Required fields are marked with *



