Recombinant Mouse Ush2A protein, His-tagged

• Cat.No.: Ush2A-4322M
• Product Overview: Recombinant Mouse Ush2A protein(Q2QI47)(265-517aa), fused with C-terminal His tag, was expressed in Yeast.

Specification

• Species: Mouse
• Source: Yeast
• Tag: His
• Protein Length: 265-517aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 30.7 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: GRMQDFRLYNVSLTNREILEVFSGDFPHLHIQPHCRCPGSHPRVHPSVQQYCIPNGAGDTPEHRMSRLNPEAHPLSFINDDDVATSWISHVFTNITQLYEGVAISIDLENGQYQVLKVITQFSSLQPVAIRIQRKKADSSPWEDWQYFARNCSVWGMKDNEDLENPNSVNCLQLPDFIPFSHGNVTFDLLTSGQKHRPGYNDFYNSSVLQEFMRATQIRLHFHGQYYPAGHTVDWRHQYYAVDEIIVSGRCQC

Gene Information

• Gene Name: Ush2a Usher syndrome 2A (autosomal recessive, mild) homolog (human) [ Mus musculus ]
• Official Symbol: Ush2A
• Synonyms: USH2A; Usher syndrome 2A (autosomal recessive, mild) homolog (human); usherin; usher syndrome type-2A protein homolog; usher syndrome type IIa protein homolog; Gm676; Gm983; Mush2a; Usherin; A930011D15Rik; A930037M10Rik
• Gene ID: 22283
• mRNA Refseq: NM_021408
• Protein Refseq: NP_067383