Recombinant Mouse Ush2A protein, His-tagged
| Cat.No. : | Ush2A-6473M | 
| Product Overview : | Recombinant Mouse Ush2A protein(Q2QI47)(265-517aa), fused with N-terminal His tag, was expressed in E.coli. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Mouse | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | 265-517aa | 
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. | 
| Molecular Mass : | 33.3 kDa | 
| Purity : | Greater than 90% as determined by SDS-PAGE. | 
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. | 
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. | 
| AA Sequence : | GRMQDFRLYNVSLTNREILEVFSGDFPHLHIQPHCRCPGSHPRVHPSVQQYCIPNGAGDTPEHRMSRLNPEAHPLSFINDDDVATSWISHVFTNITQLYEGVAISIDLENGQYQVLKVITQFSSLQPVAIRIQRKKADSSPWEDWQYFARNCSVWGMKDNEDLENPNSVNCLQLPDFIPFSHGNVTFDLLTSGQKHRPGYNDFYNSSVLQEFMRATQIRLHFHGQYYPAGHTVDWRHQYYAVDEIIVSGRCQC | 
| Gene Name | Ush2a Usher syndrome 2A (autosomal recessive, mild) homolog (human) [ Mus musculus ] | 
| Official Symbol | Ush2A | 
| Synonyms | USH2A; Usher syndrome 2A (autosomal recessive, mild) homolog (human); usherin; usher syndrome type-2A protein homolog; usher syndrome type IIa protein homolog; Gm676; Gm983; Mush2a; Usherin; A930011D15Rik; A930037M10Rik; | 
| Gene ID | 22283 | 
| mRNA Refseq | NM_021408 | 
| Protein Refseq | NP_067383 | 
| ◆ Recombinant Proteins | ||
| USH2A-6464R | Recombinant Rat USH2A Protein | +Inquiry | 
| USH2A-17894M | Recombinant Mouse USH2A Protein | +Inquiry | 
| Ush2A-6473M | Recombinant Mouse Ush2A protein, His-tagged | +Inquiry | 
| Ush2A-4322M | Recombinant Mouse Ush2A protein, His-tagged | +Inquiry | 
| USH2A-9942M | Recombinant Mouse USH2A Protein, His (Fc)-Avi-tagged | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All Ush2A Products
Required fields are marked with *
My Review for All Ush2A Products
Required fields are marked with *
  
        
    
      
            