Recombinant Mouse Vamp7 protein

Cat.No. : Vamp7-5125M
Product Overview : Recombinant Mouse Vamp7 protein(P70280)(2-220 aa) was expressed in Baculovirus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : Baculovirus
Tag : Non
Protein Length : 2-220 aa
Form : Tris/PBS-based buffer, 6% Trehalose.
AASequence : AILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRIV YLCITDDDFERSRAFSFLNEVKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQLKHHSENK SLDKVMETQAQVDELKGIMVRNIDLVAQRGERLELLIDKTENLVDSSVTFKTTSRNLARA MCMKNIKLTIIIIIVSIVFIYIIVSLLCGGFTWPNCVKK
Purity : >85% (SDS-PAGE)
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. 
Gene Name Vamp7 vesicle-associated membrane protein 7 [ Mus musculus ]
Official Symbol Vamp7
Synonyms VAMP7; vesicle-associated membrane protein 7; synaptobrevin like 1; synaptobrevin-like protein 1; tetanus neurotoxin-insensitive vesicle-associated membrane protein; Sybl1; VAMP-7; TI-VAMP;
Gene ID 20955
mRNA Refseq NM_011515
Protein Refseq NP_035645

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Vamp7 Products

Required fields are marked with *

My Review for All Vamp7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon