Recombinant Mouse Vamp7 protein
Cat.No. : | Vamp7-5125M |
Product Overview : | Recombinant Mouse Vamp7 protein(P70280)(2-220 aa) was expressed in Baculovirus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Baculovirus |
Tag : | Non |
Protein Length : | 2-220 aa |
Form : | Tris/PBS-based buffer, 6% Trehalose. |
AASequence : | AILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRIV YLCITDDDFERSRAFSFLNEVKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQLKHHSENK SLDKVMETQAQVDELKGIMVRNIDLVAQRGERLELLIDKTENLVDSSVTFKTTSRNLARA MCMKNIKLTIIIIIVSIVFIYIIVSLLCGGFTWPNCVKK |
Purity : | >85% (SDS-PAGE) |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | Vamp7 vesicle-associated membrane protein 7 [ Mus musculus ] |
Official Symbol | Vamp7 |
Synonyms | VAMP7; vesicle-associated membrane protein 7; synaptobrevin like 1; synaptobrevin-like protein 1; tetanus neurotoxin-insensitive vesicle-associated membrane protein; Sybl1; VAMP-7; TI-VAMP; |
Gene ID | 20955 |
mRNA Refseq | NM_011515 |
Protein Refseq | NP_035645 |
◆ Recombinant Proteins | ||
Vamp7-5125M | Recombinant Mouse Vamp7 protein | +Inquiry |
Vamp7-5126M | Recombinant Mouse Vamp7 protein | +Inquiry |
Vamp7-5124M | Recombinant Mouse Vamp7 protein, Avi-tagged, Biotinylated | +Inquiry |
VAMP7-4957R | Recombinant Rhesus Macaque VAMP7 Protein, His (Fc)-Avi-tagged | +Inquiry |
Vamp7-5122M | Recombinant Mouse Vamp7 protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Vamp7 Products
Required fields are marked with *
My Review for All Vamp7 Products
Required fields are marked with *