Recombinant Mouse Vcan protein, His&Myc-tagged

Cat.No. : Vcan-4519M
Product Overview : Recombinant Mouse Vcan protein(Q62059)(24-146aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His&Myc
Protein Length : 24-146aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 20.9 kDa
AA Sequence : AKMETSPPVKGSLSGKVVLPCHFSTLPTLPPNYNTSEFLRIKWSKMEVDKNGKDIKETTVLVAQNGNIKIGQDYKGRVSVPTHPDDVGDASLTMVKLRASDAAVYRCDVMYGIEDTQDTMSLA
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name Vcan versican [ Mus musculus ]
Official Symbol Vcan
Synonyms VCAN; versican; versican core protein; heart defect; PG-M core protein; large fibroblast proteoglycan; chondroitin sulfate proteoglycan 2; chondroitin sulfate proteoglycan core protein 2; Versican core protein precursor (Large fibroblast proteoglycan) (Chondroitin sulfate proteoglycan core protein 2) (PG-M); NG2; hdf; PG-M; Cspg2; DPEAAE; PG-M(V0); PG-M(V1); 9430051N09; 5430420N07Rik;
Gene ID 13003
mRNA Refseq NM_001081249
Protein Refseq NP_001074718

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Vcan Products

Required fields are marked with *

My Review for All Vcan Products

Required fields are marked with *

0
cart-icon
0
compare icon