Recombinant Mouse VSIR Protein

Cat.No. : VSIR-607M
Product Overview : Recombinant Mouse VSIR protein without tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : HEK293
Protein Length : 308
Description : Predicted to enable endopeptidase activator activity; enzyme binding activity; and identical protein binding activity. Acts upstream of or within several processes, including negative regulation of CD4-positive, alpha-beta T cell proliferation; negative regulation of T cell cytokine production; and positive regulation of BMP signaling pathway. Located in external side of plasma membrane. Is expressed in several structures, including heart; immune system; lung; male reproductive gland or organ; and small intestine lamina propria. Orthologous to human VSIR (V-set immunoregulatory receptor).
Form : Lyophilized
Molecular Mass : 19.7 kDa
AA Sequence : MGVPAVPEASSPRWGTLLLAIFLAASRGLVAAFKVTTPYSLYVCPEGQNATLTCRILGPVSKGHDVTIYKTWYLSSRGEVQMCKEHRPIRNFTLQHLQHHGSHLKANASHDQPQKHGLELASDHHGNFSITLRNVTPRDSGLYCCLVIELKNHHPEQRFYGSMELQVQAGKGSGSTCMASNEQDSDSITAAALATGACIVGILCLPLILLLVYKQRQVASHRRAQELVRMDSNTQGIENPGFETTPPFQGMPEAKTRPPLSYVAQRQPSESGRYLLSDPSTPLSPPGPGDVFFPSLDPVPDSPNSEAI
Purity : > 98%
Applications : WB; ELISA; FACS; FC
Stability : This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage : At -20 centigrade.
Concentration : 1 mg/mL
Storage Buffer : PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
Reconstitution : Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.
Gene Name Vsir V-set immunoregulatory receptor [ Mus musculus (house mouse) ]
Official Symbol VSIR
Synonyms VSIR; V-set immunoregulatory receptor; B7H5; GI24; B7-H5; Dies1; PD-1H; SISP1; VISTA; PP2135; C10orf54; DD1alpha; V-type immunoglobulin domain-containing suppressor of T-cell activation; Death Domain1alpha; PDCD1 homolog; V-domain Ig suppressor of T cell activation; V-set domain-containing immunoregulatory receptor; platelet receptor GI24; sisp-1; stress-induced secreted protein-1
Gene ID 74048
mRNA Refseq NM_028732
Protein Refseq NP_083008
UniProt ID Q9D659

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All VSIR Products

Required fields are marked with *

My Review for All VSIR Products

Required fields are marked with *

0
cart-icon