| Species : |
Mouse |
| Source : |
HEK293 |
| Protein Length : |
308 |
| Description : |
Predicted to enable endopeptidase activator activity; enzyme binding activity; and identical protein binding activity. Acts upstream of or within several processes, including negative regulation of CD4-positive, alpha-beta T cell proliferation; negative regulation of T cell cytokine production; and positive regulation of BMP signaling pathway. Located in external side of plasma membrane. Is expressed in several structures, including heart; immune system; lung; male reproductive gland or organ; and small intestine lamina propria. Orthologous to human VSIR (V-set immunoregulatory receptor). |
| Form : |
Lyophilized |
| Molecular Mass : |
19.7 kDa |
| AA Sequence : |
MGVPAVPEASSPRWGTLLLAIFLAASRGLVAAFKVTTPYSLYVCPEGQNATLTCRILGPVSKGHDVTIYKTWYLSSRGEVQMCKEHRPIRNFTLQHLQHHGSHLKANASHDQPQKHGLELASDHHGNFSITLRNVTPRDSGLYCCLVIELKNHHPEQRFYGSMELQVQAGKGSGSTCMASNEQDSDSITAAALATGACIVGILCLPLILLLVYKQRQVASHRRAQELVRMDSNTQGIENPGFETTPPFQGMPEAKTRPPLSYVAQRQPSESGRYLLSDPSTPLSPPGPGDVFFPSLDPVPDSPNSEAI |
| Purity : |
> 98% |
| Applications : |
WB; ELISA; FACS; FC |
| Stability : |
This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
| Storage : |
At -20 centigrade. |
| Concentration : |
1 mg/mL |
| Storage Buffer : |
PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
| Reconstitution : |
Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |