Recombinant Mouse Wnt8b Protein, His-SUMO/MYC-tagged

Cat.No. : Wnt8b-1051M
Product Overview : Recombinant Mouse Wnt8b Protein (2-350aa) was expressed in E. coli with N-terminal His-SUMO and C-terminal MYC tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His&Myc&SUMO
Protein Length : 2-350 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 56.2 kDa
AA Sequence : WSVNNFLMTGPKAYLVYSSSVAAGAQSGIEECKYQFAWDRWNCPERALQLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNGQLGGQGWLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAVKGTMKRTCKCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRRLCGDCGLAVEERRAETVSSCNCKFHWCCAVRCEQCRRRVTKYFCSRAERPPRGAAHKPGKNS
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name Wnt8b wingless-type MMTV integration site family, member 8B [ Mus musculus (house mouse) ]
Official Symbol Wnt8b
Synonyms Wnt8b
Gene ID 22423
mRNA Refseq NM_011720.3
Protein Refseq NP_035850.2
UniProt ID Q9WUD6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Wnt8b Products

Required fields are marked with *

My Review for All Wnt8b Products

Required fields are marked with *

0

Inquiry Basket

cartIcon