Recombinant Mouse Ywhaz protein, His-SUMO-tagged

Cat.No. : Ywhaz-3780M
Product Overview : Recombinant Mouse Ywhaz protein(P63101)(1-245aa), fused to N-terminal His-SUMO tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His&SUMO
Protein Length : 1-245aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 43.8 kDa
AA Sequence : MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQPESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name Ywhaz tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide [ Mus musculus ]
Official Symbol Ywhaz
Synonyms YWHAZ; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide; 14-3-3 protein zeta/delta; SEZ-2; KCIP-1; protein kinase C inhibitor protein 1; AI596267; AL022924; AU020854; 14-3-3zeta; 1110013I11Rik;
Gene ID 22631
mRNA Refseq NM_001253805
Protein Refseq NP_001240734

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Ywhaz Products

Required fields are marked with *

My Review for All Ywhaz Products

Required fields are marked with *

0

Inquiry Basket

cartIcon