Recombinant Mouse Ywhaz protein, His-SUMO-tagged
| Cat.No. : | Ywhaz-3780M |
| Product Overview : | Recombinant Mouse Ywhaz protein(P63101)(1-245aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-245aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 43.8 kDa |
| AA Sequence : | MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQPESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Ywhaz tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide [ Mus musculus ] |
| Official Symbol | Ywhaz |
| Synonyms | YWHAZ; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide; 14-3-3 protein zeta/delta; SEZ-2; KCIP-1; protein kinase C inhibitor protein 1; AI596267; AL022924; AU020854; 14-3-3zeta; 1110013I11Rik; |
| Gene ID | 22631 |
| mRNA Refseq | NM_001253805 |
| Protein Refseq | NP_001240734 |
| ◆ Recombinant Proteins | ||
| YWHAZ-831H | Recombinant Human YWHAZ Protein, His-tagged | +Inquiry |
| YWHAZ-203H | Recombinant Human YWHAZ protein, T7/His-tagged | +Inquiry |
| YWHAZ-5831H | Recombinant Human YWHAZ protein, His-tagged | +Inquiry |
| YWHAZ-843H | Recombinant Human YWHAZ Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| YWHAZ-2799H | Recombinant Human YWHAZ Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| YWHAZ-229HCL | Recombinant Human YWHAZ 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ywhaz Products
Required fields are marked with *
My Review for All Ywhaz Products
Required fields are marked with *
