Recombinant Mouse Ywhaz protein, His-SUMO-tagged
Cat.No. : | Ywhaz-3780M |
Product Overview : | Recombinant Mouse Ywhaz protein(P63101)(1-245aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-245aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 43.8 kDa |
AA Sequence : | MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQPESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Ywhaz tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide [ Mus musculus ] |
Official Symbol | Ywhaz |
Synonyms | YWHAZ; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide; 14-3-3 protein zeta/delta; SEZ-2; KCIP-1; protein kinase C inhibitor protein 1; AI596267; AL022924; AU020854; 14-3-3zeta; 1110013I11Rik; |
Gene ID | 22631 |
mRNA Refseq | NM_001253805 |
Protein Refseq | NP_001240734 |
◆ Recombinant Proteins | ||
YWHAZ-153H | Recombinant Human YWHAG Protein, His-tagged | +Inquiry |
YWHAZ-4900H | Recombinant Human Tyrosine 3-Monooxygenase/Tryptophan 5-Monooxygenase Activation Protein, Zeta Polypeptide, GST-tagged | +Inquiry |
YWHAZ-18687M | Recombinant Mouse YWHAZ Protein | +Inquiry |
YWHAZ-2997C | Recombinant Chicken YWHAZ | +Inquiry |
YWHAZ-2381H | Recombinant Human YWHAZ Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
YWHAZ-229HCL | Recombinant Human YWHAZ 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ywhaz Products
Required fields are marked with *
My Review for All Ywhaz Products
Required fields are marked with *