Recombinant Mycobacterium Tuberculosis CFP2 Protein (49-168 aa), His-tagged
Cat.No. : | CFP2-1626M |
Product Overview : | Recombinant Mycobacterium Tuberculosis (strain CDC 1551/Oshkosh) CFP2 Protein (49-168 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycobacterium Tuberculosis |
Source : | Yeast |
Tag : | His |
Protein Length : | 49-168 aa |
Description : | May play a role in the development of protective immune responses. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 14.1 kDa |
AA Sequence : | DPASAPDVPTAAQLTSLLNSLADPNVSFANKGSLVEGGIGGTEARIADHKLKKAAEHGDLPLSFSVTNIQPAAAGSATADVSVSGPKLSSPVTQNVTFVNQGGWMLSRASAMELLQAAGN |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | cfp2 low molecular weight antigen MTB12 [ Mycobacterium tuberculosis H37Rv ] |
Official Symbol | CFP2 |
Synonyms | mtb12; |
Gene ID | 885515 |
UniProt ID | P9WIN6 |
◆ Recombinant Proteins | ||
CFP2-1626M | Recombinant Mycobacterium Tuberculosis CFP2 Protein (49-168 aa), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CFP2 Products
Required fields are marked with *
My Review for All CFP2 Products
Required fields are marked with *
0
Inquiry Basket